[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55228.1"

            "5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase"
            ""

OrgPattern -------------------------------------------------------------------- -----------------11-1---11111111--------------11-------1-------1-------111111111-1---------1--11----1-----111----------------------------------------1---11--111-----------------1----1111------11333232432333333121111433111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111122111--1-11-----------------11-1----1-----------------------------------------------------------------------------------1------------------------------------111--1---1111111111111111--11-111----111---111---1--------1111111-1--------2-----1----1-11--1---------11111111111111111111111111--1111--1-11111111112111111211111-1----11-11111111111111111111-11111111111111111111111111111111111111111111111111111111111111111--1-------------11111111111111111------1----------------------111111111111111111112111-----------------1------43312111111----1---1--------11---111-1--1-------- -----------2------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------------1---------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKIGIIAAMPEELAYLVQHLDNAQEQVVLGNTYHTGTIASHEVVLVESGIGKVMSAMSVA:Sequence :cEEEEEEccHHHHHHHHHTcEEEEEEEETTEEEEEEEETTEEEEEEEccccHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->229|1jysA|1e-42|40.0|225/226|c.56.2.1 :============================================================:BL:SWS|1->229|MTNN_LISW6|5e-54|46.3|229/233 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->200|PF01048|2e-18|33.5|170/229|PNP_UDP_1 61: . . . * . .: 120 :ILADHFQVDALINTGSAGAVAEGIAVGDVVIADKLAYHDVDVTAFGYAYGQMAQQPLYFE:Sequence :HHHHHHcccEEEEEEEEEEccTTccTTcEEEEEEEEEcccccGGGTccTTccTTccccEE:Sec Str :============================================================:RP:SCP|1->229|1jysA|1e-42|40.0|225/226|c.56.2.1 :============================================================:BL:SWS|1->229|MTNN_LISW6|5e-54|46.3|229/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->200|PF01048|2e-18|33.5|170/229|PNP_UDP_1 121: . . + . . .: 180 :SDKTFVAQIQESLSQLDQNWHFGLIATGDSFVAGNDKIEAIKSHFPEVLAVEMEGAAIAQ:Sequence :ccHHHHHHHHHHHHHHTccEEEEEEEEcccccccHHHHHHHHHHcTTEEEEEccHHHHHH:Sec Str : XXXXX:SEG|176->184|aaiaqaaha :============================================================:RP:SCP|1->229|1jysA|1e-42|40.0|225/226|c.56.2.1 :============================================================:BL:SWS|1->229|MTNN_LISW6|5e-54|46.3|229/233 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|30->200|PF01048|2e-18|33.5|170/229|PNP_UDP_1 181: . * . . . .: 240 :AAHALNLPVLVIRAMSDNANHEANIFFDEFIIEAGRRSAQVLLTFLKALD :Sequence :HHHHTTccEEEEEEEEEcccTTHHHHHHHHHHHHHHHHHHHHHHHHHHHH :Sec Str :XXXX :SEG|176->184|aaiaqaaha :================================================= :RP:SCP|1->229|1jysA|1e-42|40.0|225/226|c.56.2.1 :================================================= :BL:SWS|1->229|MTNN_LISW6|5e-54|46.3|229/233 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|30->200|PF01048|2e-18|33.5|170/229|PNP_UDP_1