[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55245.1"

            "Transcriptional activator TenA"
            ""

OrgPattern 11--1-1122222222-111111-1---1122-----------------------11---111----- -------------1-------1---1------1111-111-1------1---1111----------1---1-1111-1----1------------------------11----------------------------1111---12--1---11111----------1-111----11-1--1--------11122222222222222221222122211--2111111111121111111111111-211111-1-11-1-------111-111-111111-------22222222221---------------------------1-------1-1-----11------------------1-----------------------1----1-----11111111111-11-11111--------11-111-------1-1----21----------11------------------------------1-12-------------------------------------------------------11------------------------2--------------------------------111111--1111111-----------------1---------------------------------------------------------------------111-------------------------------------------------------------111----1111---11111111--------------------------------1111-----111-------------------111----------------------------------------------------- ---------------11---1111--11111111-1-1111111-1----1-11-11---11--------------1--1----1-11--2111---------11----1-------------------------------------------------------------------------111---1-111----1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEFTDIAMELSKKAWQASFHHPFILQLQEGNLEPAIFRYYLIQDAYYLKAFSEIYHLLAD:Sequence :cHHHHHHHHTTHHHHHHHHTcHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->215|1uddA|4e-51|23.8|210/215|a.132.1.3 :============================================================:BL:SWS|1->218|TENA_BACSU|1e-34|32.6|218/236 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->212|PF03070|2e-25|32.8|198/208|TENA_THI-4 61: . . . * . .: 120 :KTSNQEMKRLLKQNAQGLVEGELFIRQQFFKELEISDQEMEQHPIAPTCYHYISHIYRQF:Sequence :cccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHTTccHHHHHTccccHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->215|1uddA|4e-51|23.8|210/215|a.132.1.3 :============================================================:BL:SWS|1->218|TENA_BACSU|1e-34|32.6|218/236 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->212|PF03070|2e-25|32.8|198/208|TENA_THI-4 121: . . + . . .: 180 :AEPNLAIAFASLLPCPWLYHDIGKSLNLKPSPNPLYQQWIETYITDELEQQIREEGALVN:Sequence :HTcHHGGHHHHHHHHHHHHHHHHTccccccccHHTHHHHHHTTccHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|1->215|1uddA|4e-51|23.8|210/215|a.132.1.3 :============================================================:BL:SWS|1->218|TENA_BACSU|1e-34|32.6|218/236 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|15->212|PF03070|2e-25|32.8|198/208|TENA_THI-4 181: . * . . . .: 240 :QLYRESDETDKQKMLDAFHISVHMEAKFWEMAYQHQTWKSDLQSLEKGEE :Sequence :HHTTHTTcTTHHHHHHHHHHHHHHHHHHHHGGGHHHHTTcT :Sec Str :=================================== :RP:SCP|1->215|1uddA|4e-51|23.8|210/215|a.132.1.3 :====================================== :BL:SWS|1->218|TENA_BACSU|1e-34|32.6|218/236 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|15->212|PF03070|2e-25|32.8|198/208|TENA_THI-4