[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55294.1 spne4 ACF55294.1 "conserved hypothetical protein"
MILMTKNINLTNEELELIQGGADPYGKEPNGYYPWKMEPVLTLLVHGFCPRDTDDLGYIG
GGNHLCKGSAARF
//