[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55303.1"

            "Dna polymerase III, epsylon subunit/ATP-dependent helicase DinG"
            ""

OrgPattern -------------------------------------------------------------------- 111111------1--------1---1------1---11111---1-11-------1----11-11221111--11---1111121-11-----------11222311111--------------1---------1-11111---12--------------------1----------------1--21---23233333233333333323222233322223222222222322222222222222222222333433423333322333333222222222222222222222222222222222222222222231222211111111111121211111111221113221122121123211111-222-1------------11------------------------1------------------------2-11111111-------------11------------------------------------111112222222111122221111112222322-1111112222223132252212211222222112433----1----------11111111111112111---11-111-1-----------11-11332211212332333332323332333333--11231------11111111111111111-111111111111111111111111111111111111111111121111111--111111111111---1-----1111112111111111111-1111----------1111111111111111111---------122222222222222222222222211111111111111---1-1112---1--------------11-------111112--12111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKTIGNRYVVVDLEATSTGSKAKIIQVGIVVIEDGEIVDHYTTDVNPHEPLDAHIKELTG:Sequence : cEEEEEEEEEcccTTcccccccEEEEEEEEEETTEEEEEccccccccHHHHHHHc:Sec Str : XXXXXXXXXXXXXXXX :SEG|24->39|iiqvgivviedgeivd : =====================================================:RP:SCP|8->180|1wljA|5e-23|19.9|166/168|c.55.3.5 : ======================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 : $$$$$$$$$$$$$$$$:RP:PFM|45->162|PF00929|5e-17|42.4|118/163|Exonuc_X-T 61: . . . * . .: 120 :LTDQRLAQAPDFSQVARKIFDLVEDGIFVAHNVQFDANLLAENLFFEGYELRNPRVDTVE:Sequence :ccHHHHHTcccHHHHHHHHHHccTTcEEEEEcccHHHHTHHHHHHHHTTcccGGGcEEEE:Sec Str :============================================================:RP:SCP|8->180|1wljA|5e-23|19.9|166/168|c.55.3.5 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|45->162|PF00929|5e-17|42.4|118/163|Exonuc_X-T 121: . . + . . .: 180 :LAQVFFPELEKYSLPILCRELGIPLKHAHTALSDAQATAELLLFLREKMTQLPKGLLERL:Sequence :HHHHHHHHHcccHHHHHHHHHTcccccTTcHHHHHHHHHHHHHHHHHTTccccccEEEEc:Sec Str :============================================================:RP:SCP|8->180|1wljA|5e-23|19.9|166/168|c.55.3.5 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|45->162|PF00929|5e-17|42.4|118/163|Exonuc_X-T 181: . * . . . .: 240 :LEMADALLYESYLVIEETYRNQSILSSPDLVQVQGLYFKKTAASLELRKLSQDFSKNISL:Sequence :ccGGGcTTGccccccTTGGGcHHHHHHHHHHHccHcEEEEccGGGccGGGTTccTTTccT:Sec Str :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 241: + . . . . *: 300 :LNLEVREEQESFAKEVGLLLKDEPVSLIQAPTGIGKTYGYLLPALSQSKERQIVLSVPTK:Sequence :TTcccccccGGGcccTTcccHHHHHcEEEccccccHHHHHHHHHTTTHHccEEEEEEccc:Sec Str : ==================================:RP:SCP|267->363|1a1vA1|2e-07|10.5|95/136|c.37.1.14 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|267->316|PF00270|2e-05|48.0|50/167|DEAD 301: . . . . + .: 360 :ILQNQIMEEEGKRLKEVFHTDIHSLKGPQNYLKLDAFYHSLQENDENRLFRRFKMQVLVW:Sequence :GGGHHHHHHHHccccHHHHHHHHHHccGGGcTTcTTccccccTHHHHHHHHHHHHHcGGG:Sec Str :============================================================:RP:SCP|267->363|1a1vA1|2e-07|10.5|95/136|c.37.1.14 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 :$$$$$$$$$$$$$$$$ :RP:PFM|267->316|PF00270|2e-05|48.0|50/167|DEAD 361: . . . * . .: 420 :LTETETGDLDEIGQLYRYQHFLADLRHDGNLSSHSLFVTEDFWKRSQERAETCKLLVTNH:Sequence :ccHHHHHHHHHccHHHHHHHHHHHccTTEEEEEcccTTcHHHHHHTTTcHHHHHHHHHHH:Sec Str :=== :RP:SCP|267->363|1a1vA1|2e-07|10.5|95/136|c.37.1.14 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 421: . . + . . .: 480 :AYLVTRLEDNPEFVSDRLLIIDEVQKILLALENLLQETYDIQSIIDLIDKALVGEENRVQ:Sequence :HHEEEcGGGTccEcccEEEEEccccHHHHHHHHHHHH :Sec Str :================ :BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 481: . * . . . .: 540 :QRILESIRFECLYLIEQFQSGKSRKNILDSLDNLHQYFSELEVEGFDELVRYFTAEGDYW:Sequence : :Sec Str 541: + . . . . *: 600 :LEVTETSQKKIQISSTKSGRTLLSSLLPESCQVLGVSATLEISQRVSLADLLGYPEAKFV:Sequence : GGGGGcEEEEEcccccHHHHHTc cccEE:Sec Str : XXXXXXXXXXXXX :SEG|546->558|tsqkkiqisstks : ==========================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 601: . . . . + .: 660 :KIESRGKQEQEVVMVKDFPLVTETSLEVYAREVAALLVEIQAFQQPILVLFTAKDMLLAV:Sequence :cccccccGGGEEEEEEccccccHHHHHHHHHHHHHHHHHHHTcccEEEEEEccHHHHHHH:Sec Str : ============================:RP:SCP|633->723|1gkuB2|4e-04|11.0|91/242|c.37.1.16 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 661: . . . * . .: 720 :SDLLTVSHLAQYKNGDVHQLKKRFEKGEQQILLGAASFWEGVDFSSHPFVIQVVPRLPFQ:Sequence :HTTccccEEEccccccHHHHHTTcccccccEEEccccccccccccccccccEEEEccccc:Sec Str :============================================================:RP:SCP|633->723|1gkuB2|4e-04|11.0|91/242|c.37.1.16 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 721: . . + . . .: 780 :NPQEPLTKKINQELNQEGKNAFYDYQLPMAIIRLKQALGRSMRREYQRSLTLILDRRIVG:Sequence :cccHHHHHHHHTTTcccccTTHHHHTHHHHHHHHHHHHHTTccccccccEEEEEcGGGGc:Sec Str :=== :RP:SCP|633->723|1gkuB2|4e-04|11.0|91/242|c.37.1.16 :============================================================:BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931 781: . * . . . .: 840 :KRYGKQIVASLAEEATVKTISRSEVDEAIDRFFNEL :Sequence :HHHHHHT :Sec Str :========================== :BL:SWS|7->436,559->806|DING_BACSU|2e-46|31.2|671/931