[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55326.1"

            "glyoxalase family protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------11----1---1------1111-------1----------------11---------1---311--1-----------------------------------------------------------------1-------------------1--------------------------------------------------------------------------------------------------------------11--------11-1111111111-------------1--------------------------------------------------------------1111------1223---1--1-22222222222---------132-4--122122132121----12112-----------------11---------------------------------------22232221----11--1111-13-11-22---1---1111-1---11----1---------------1-------------------------1--3-----------------------------12-------------------------------------------11-1---------------1---------------23211------------------------------------------------------------------------------------1---------1---------------------------1--312221211222--------------------------------------------------------------- ---------------111222232-2222222211-2222222222--111111-2111---------------------------------11-2----------------------------------------------------------------------------------------1---21--------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQD:Sequence :cccccEEEEccHHHHHHHHHTTTcETTcEEEEEcccEEEEEETTEEEEEEEcTTccGGGc:Sec Str :============================================================:RP:SCP|1->120|1ecsA|1e-12|13.2|114/120|d.32.1.2 : ==========================:BL:SWS|35->63|SYL_SYNPW|8e-04|48.3|29/100 61: . . . * . .: 120 :PVHFAFLAENKEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHK:Sequence :ccEEEEHHHHHHHHHHTTcccccccccEEEEEEEEEcTTccEEEEEEcTTccEEEEEEcc:Sec Str :============================================================:RP:SCP|1->120|1ecsA|1e-12|13.2|114/120|d.32.1.2 :=== :BL:SWS|35->63|SYL_SYNPW|8e-04|48.3|29/100 121: . . + . . .: 180 :E :Sequence :c :Sec Str