[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55326.1 spne4 ACF55326.1 "glyoxalase family protein"
MIDHFEIKVKDLQISEGFYRSFLAPLDYKMTFKTSSLISFLSPNSPHPGGDFWLTQGTQD
PVHFAFLAENKEEVQACYEAGLEAGGRDNGAPGYRSEHPIYYAAFMIDLDGNNIEVVCHK
E
//