[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55441.1 spne4 ACF55441.1 "conserved hypothetical protein"
MTSDKAGLERKFAAKERKRNKPGVVLCGSMDELCALAQLNPEIEAFY
//