[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55446.1"

            "oxalate:formate antiporter"
            ""

OrgPattern ------1-1111111--------2----1-----------------111------------11----- 12-----------------------2------------------1--1-----11--1------1-1211-----111--11---------------------1--------------------------------------------11--111----------------------------1----1-----22222222122222211221-2221111---111-111------------------------11111-1---1111-1-1-1-111111------111111211111111111111111---111---112---1111111-1-1-----------------221-2---1111------1----------12533--3311-1------------65654354----1111--12111133-----1-------------------2-----------------------------------1---1111-111-11----1133--------24533-3111--1------1146--111-11111111--------1---1---111---2121111-2222--221--------------------------11----------1--1------------1--------------11212111111111111-111111111111111111121111---1-11111111111111111111111-1----------------------------1111---1--------------1---------1111-1111-111----------11121111111111--11111111--------------------------------------------------------------- ----312-----131----1----1-1----------------------2-----1------------------------------------------------21-------------------------------------------------------------------2--------1--1---1--1-4664- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKSNRYIIAFAGVILHLMLGSTYAWSVYRNPIIEKTGWDQASVAFAFSLAIFCLGLSAAF:Sequence :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 : =========================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 61: . . . * . .: 120 :MGRLVXKFGPRVMGSLSAFLYAGGNILTGFAIDRQELWLLYLAYGILGGLGLGAGYITPV:Sequence : XXXXXXXXXXXXXXXXXXX :SEG|99->117|llylaygilgglglgagyi :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 :============================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 121: . . + . . .: 180 :STIIKWFPDKRGLATGLAIMGFGFASLLTSPIAQHLIAGVGLVETFYILGASYFIIMLLA:Sequence :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 :============================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 181: . * . . . .: 240 :SQFIKRPNEQELAILSASGKEKTDSLTQGMTANQALKSNRFYILWIIFFINIACGLGLIS:Sequence :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 :============================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 241: + . . . . *: 300 :AASPMAQEMAGLSTSHAAVMVGVLGIFNGFGRLLWASLSDYIGRPLTFSILLLVNLLFSL:Sequence : XXXXXXXXXXXXXXX:SEG|286->305|ltfsilllvnllfslslwlf :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 :============================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 301: . . . . + .: 360 :SLWLFTDSVLFVVAMSILMTCYGAGFSLIPAYLSDIFGTKELAALHGYILTAWAMAGLAG:Sequence :XXXXX :SEG|286->305|ltfsilllvnllfslslwlf :============================================================:RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1 :============================================================:BL:SWS|4->360|OXLT_OXAFO|3e-27|31.4|344/418 361: . . . * . .: 420 :PILLAETYKMAHSYTQTLFVFLILYSIALALSYYLGRSIKKESQKPLT :Sequence : XXXXXXXXXXXXXX :SEG|382->395|lilysialalsyyl :=== :RP:SCP|1->363|1pw4A|9e-07|12.5|361/434|f.38.1.1