[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55485.1"

            "glycosyl transferase, group 1 family protein"
            ""

OrgPattern ---------------11-------11111211---1--------2122--11-1-1-1-1-------- ----------------------------------------------11------------------------------------1-2------1----------------------------------------2-----1---1-1-----------------1---11------------------23---------------1---1---------------1111111---------------------1111111111111111111111111111111111111111111111111111111111111111111111---1------------------1--111-----------1---------1-1----------------------1--------------------1--------------1------------------------------------------------------------------------------------------------------------------------------------1---------1-2------1---1--1--------11---1-----------------1---------1-----------------------------11--------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------2-----------------2-------------------------112---1---1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEKKKLRINMLSSSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTID:Sequence : EEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHTTccccEEEEETGG:Sec Str : =========:RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 61: . . . * . .: 120 :FPYYLSTFQKKRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNP:Sequence :GHHHHHHHHHHHcccEEEEEcccEHHHHHHTTcGGGccccEEcHHHHHHHHccEEEEccH:Sec Str :============================================================:RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 : =======================:BL:SWS|98->274|Y1607_METJA|3e-09|24.7|174/390 121: . . + . . .: 180 :MFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQK:Sequence :HHHHHTHHHGGGTTTEEEccccccTTTccGGHHHHHHHHHHHTTccccEEEEEEcccccc:Sec Str :============================================================:RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 :============================================================:BL:SWS|98->274|Y1607_METJA|3e-09|24.7|174/390 : $$$$$$$$$$:RP:PFM|171->318|PF00534|3e-11|32.4|142/165|Glycos_transf_1 181: . * . . . .: 240 :RKGIDDFIRLAEELPQITFIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVSPERMR:Sequence :cccHHHHHHHHHHHTTcGGGGGEEEEEEccccHHHHHHHHHHTcTTEEEEcccccHHHHH:Sec Str :============================================================:RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 :============================================================:BL:SWS|98->274|Y1607_METJA|3e-09|24.7|174/390 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->318|PF00534|3e-11|32.4|142/165|Glycos_transf_1 241: + . . . . *: 300 :ELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLYKVILEGNYRATAGREEMKEA:Sequence :HHHTTccEEEEccccccccHHHHHHHTTTcEEEEEccTTHHHHcccEEEcTTcHHHHHHH:Sec Str :============================================================:RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 :================================== :BL:SWS|98->274|Y1607_METJA|3e-09|24.7|174/390 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|171->318|PF00534|3e-11|32.4|142/165|Glycos_transf_1 301: . . . . + .: 360 :ILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKQAALGRK :Sequence :HHHHHTTTTccTHHHHHHHHHHHHccHHHHHHHHHHHHHTHHHHHTc :Sec Str :======================================== :RP:SCP|52->340|1gz5A|4e-29|10.4|279/456|c.87.1.6 :$$$$$$$$$$$$$$$$$$ :RP:PFM|171->318|PF00534|3e-11|32.4|142/165|Glycos_transf_1