[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55485.1 spne4 ACF55485.1 "glycosyl transferase, group 1 family protein"
MEKKKLRINMLSSSEKVAGQGVSGAYRELVRLLHRAAKDQLIVTENLPIEADVTHFHTID
FPYYLSTFQKKRSGRKIGYVHFLPATLEGSLKIPFFLKGIVKRYVFSFYNRMEHLVVVNP
MFIEDLVAAGIPREKVTYIPNFVNKEKWHPLPQEEVVRLRTDLGLSDNQFIVVGAGQVQK
RKGIDDFIRLAEELPQITFIWAGGFSFGGMTDGYEHYKKIMENPPKNLIFPGIVSPERMR
ELYALADLFLLPSYNELFPMTILEAASCEAPIMLRDLDLYKVILEGNYRATAGREEMKEA
ILEYQANPAVLKDLKEKAKNISREYSEEHLLQIWLDFYEKQAALGRK
//