[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55561.1"

            "integrase/recombinase, phage integrase family"
            ""

OrgPattern --1111111111111-1---------------11111--55731-111-1511-1111111211---- 3251122122222222222-2322312222217324112-1131-1112111223122111-22133---1222226532222---11332422222--422253222221222222111222222222222223211111236223-51-1------1----1---338--------------2--1222332454552353475336323322233856923332224243222222222222222233222222222-32222222234222211211111111112112322222211222111111111--111-1-1383344323423432313322112321321644449735143222242-2126122-21222--22----1311-----------1--1----1-1211----2-3---21-1---11-----23-111111115--1--112221211-222111111111221112222-1-1111---12222222222222222222222222233111131221212322123122222-2222222222-111242-223214221222322222211222222--------------------2-1-132232321-23232332232223222323221--23122------23442322222222222-222222222222222222222282A832222232222222223222222222-222222222222--12---------222222221212111-22221112111212222222332323333224322222222222225222221222322222222222222--11332222--------222------1--1--------1------11-1112111262 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MESKVTIIMQEMLPLLNNEQLLALRESLEHHLVDGKKQQKYSNNNLLQLFITAKQVEGCS:Sequence : EEEEEEEEEEEcHHHHHHHHHHHHTGGcc:Sec Str : XXXXXXXXXXXXXXX :SEG|10->24|qemlpllnneqllal : ==================:RP:SCP|43->127|1crxA1|7e-08|10.7|84/110|a.60.9.1 : =================:BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 61: . . . * . .: 120 :SKTIRYYQRTIENLFNAIKESVTQLTTDDLRSYLANYQSEKDCSKANLDNIRRILSSFFA:Sequence :HHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|43->127|1crxA1|7e-08|10.7|84/110|a.60.9.1 :============================================================:BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 121: . . + . . .: 180 :WLEQEEYIIKNPIRRIKKIKTEQNVKETYTDEHLEIMRDNCENLRDLAIIDLLASTGMRV:Sequence :TcccccGGGcHHHHHHHHHHHHHHHTTTccccccccccccHHHHHHHHHHHHHHHHTccH:Sec Str : XXXXXXXXXXXXX :SEG|128->140|iiknpirrikkik :======= :RP:SCP|43->127|1crxA1|7e-08|10.7|84/110|a.60.9.1 : =======================:RP:SCP|158->304|1a0pA2|2e-21|29.9|147/180|d.163.1.1 :============================================================:BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 : $$$$$$$$$$$$$$$$$:RP:PFM|164->307|PF00589|7e-18|42.3|142/168|Phage_integrase 181: . * . . . .: 240 :GELVQLNRSDIDFENRECVVFGKGKKERPVYFDARTKIHLRNYLNDRKDSHPALFVTLVG:Sequence :HHHHHcccTTcccccTTccccccccHHHHHHHHHHHHHTccccccTTccccccccccccH:Sec Str :============================================================:RP:SCP|158->304|1a0pA2|2e-21|29.9|147/180|d.163.1.1 :============================================================:BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->307|PF00589|7e-18|42.3|142/168|Phage_integrase 241: + . . . . *: 300 :KAQRLGIAGVEIRLRKLGDKLGIQKVHPHKFRRTLATKAIDKGMPIEQVQKLLGHSKIDT:Sequence :HHHHHHHHHHHHHHHccccccccccccTTHHHHHHHHHHHHccccHHHHHHTTTcccTTc:Sec Str :============================================================:RP:SCP|158->304|1a0pA2|2e-21|29.9|147/180|d.163.1.1 :============================================================:BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|164->307|PF00589|7e-18|42.3|142/168|Phage_integrase 301: . . . . + .: 360 :TLAYAMVNQNNVKHSHQKFIS :Sequence :ccccHHHHHccccHHHHHH :Sec Str :==== :RP:SCP|158->304|1a0pA2|2e-21|29.9|147/180|d.163.1.1 :============= :BL:SWS|44->313|XERC_STAAB|3e-27|30.7|267/298 :$$$$$$$ :RP:PFM|164->307|PF00589|7e-18|42.3|142/168|Phage_integrase