[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55636.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----11-1--111111--111111111111111-----1----------------1--------11111111111111111111111111111111111111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRKFKIFLFIEACLLTGALILMVSEHFSRFLLILFLFLLLIRYYTGKEGNNLLLVAATIL:Sequence : XXXXXXXXXXXX :SEG|30->41|fllilflfllli : ==================:BL:SWS|43->229|LIAF_BACSU|3e-08|24.5|184/100 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->229|PF09922|8e-11|32.2|205/220|DUF2154 61: . . . * . .: 120 :FFFIVMLNPFVILAIFVAVIYSLFLLYPMMNQEKEQTNLVFEEVVTVKKEKNRWFGNLHH:Sequence : XXXXXXXXXX :SEG|102->111|eevvtvkkek :============================================================:BL:SWS|43->229|LIAF_BACSU|3e-08|24.5|184/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->229|PF09922|8e-11|32.2|205/220|DUF2154 121: . . + . . .: 180 :FSSYQTCQFDDINLFRFMGKDTIHLERVILTNHDNVIILRKMVGTTKIIVPVDVEVSLSV:Sequence :============================================================:BL:SWS|43->229|LIAF_BACSU|3e-08|24.5|184/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|6->229|PF09922|8e-11|32.2|205/220|DUF2154 181: . * . . . .: 240 :NCLYGDLTFFNQPKRALRNEHYHQETKDYLKSNKSVKIFLTTMIGDVEVVRG :Sequence :================================================= :BL:SWS|43->229|LIAF_BACSU|3e-08|24.5|184/100 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|6->229|PF09922|8e-11|32.2|205/220|DUF2154