[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55668.1"

            "glycerol dehydrogenase"
            ""

OrgPattern ------11----------11111-122--111-1-1-------12--111111--11--111-----1 ------1------------------------------------1-----------------------1111-111---2--1-1------------------------1----------------1-------1------------11111111122111212111111111111111111-1----------2---------------2-221-----1--222111111-1----------------11--3-1-11-1-----1111-1-1--11122211111221111111111111111111111111111--111---1-22222222423----222--2---2-----------1-1------1------------------------------------------1---------1------11-21-------------------------------------------------------11------1----1------------------------1-----------------2-----------------------2----------------1------------1---------------------------221---1-----1111------1----11--------------3131-2-2222232322-223232222222222222234333112323222333332322322221112--211111111111--2----------------------------------------1-------------1------------------------1--1-----------------1-------------------------------------------1---1-111--- ----21--------------------------------------------------------------------------------11-22---2-------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRIFASPSRYIQGENALFENAKSILDLGNYPILLCDQLVYDIVGKRFEDYLHRYGFHIVL:Sequence :EEEETTEEEEEEcTTHHHHTHHHHHHcccEEEEEEETTTHHHHHHHHHHHHHHHTEEEEE:Sec Str : ===========================================================:RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 : ===========================================================:BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 61: . . . * . .: 120 :ALFNGEASDNEINRVVALAEKENCDSIIGLGGGKTIDSAKAIADLIEKPVIIAPTIASTD:Sequence :cccGGGccHHHHHHHHHHHHTccccEEEEEEcHHHHHHHHHHHHHGGGEEEEEEccHHHH:Sec Str :============================================================:RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 :============================================================:BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 121: . . + . . .: 180 :APVSALSVIYTDEGAFDHYLFYSKNPDLVLVDTKVISQAPKRLLASGIADGLATWVEARA:Sequence :HTTTcccEEEEEETTEEEEEEEEccccEEEEcGGGGGGccHHHHHHHHHHHHHHHHTTcH:Sec Str :============================================================:RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 :============================================================:BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 181: . * . . . .: 240 :VMQANGKTMLGQQQTLAGVAIAKKCEETLFADGLQAMAACEAKVVTPALENIVEANTLLS:Sequence :HHHHHHHHHHHHHHcccccHHHHGGGHHHHHHHHHHHHHHHHHHHHHHcTTcccGGGHHH:Sec Str : XXX:SEG|238->252|llsglgfesgglaaa : #:PROS|240->260|PS00060|ADH_IRON_2|PDOC00059| :============================================================:RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 :============================================================:BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 241: + . . . . *: 300 :GLGFESGGLAAAHAIHNGFTALTGDIHHLTHGEKVAYGTLVQLLLENRPKEELDKYIEFY:Sequence :HHTccTTGGGTTHHHHHHHHHHHTccTTccHHHHHHHHHHHHHHHHHHTHHHHHHHHHHH:Sec Str :XXXXXXXXXXXX :SEG|238->252|llsglgfesgglaaa :#################### :PROS|240->260|PS00060|ADH_IRON_2|PDOC00059| : ######## :PROS|244->251|PS00687|ALDEHYDE_DEHYDR_GLU|PDOC00068| :============================================================:RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 :============================================================:BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 301: . . . . + .: 360 :KKIGMPTTLKEMHLDQVGYDDLIKVGKQATMEGETIHQMPFKISPSDVAQAIIAVDAYVN:Sequence :HHTTccccTTcHHHHHHcTTccccHHHHHTTcTTccTTccEEccEEETTEEccccHEEc :Sec Str :========================================================== :RP:SCP|2->358|1jpuA|4e-94|51.6|351/361|e.22.1.2 :===================================== :BL:SWS|2->337|GLDA_BACST|8e-89|52.4|336/370 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->345|PF00465|1e-16|31.7|309/364|Fe-ADH 361: . . . * . .: 420 :SK :Sequence : :Sec Str