[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55672.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MMKNSFQKSNFLYYGIILVSVLVEVIMICQLESLVPLLYPSFIGFLVFHVLYHLILFLVA:Sequence 61: . . . * . .: 120 :KRSGRWDYLMIWGLFLMFNLLYDSFLGLLFLGLSFGM :Sequence : XXXXXXXXXXXXX :SEG|84->96|sflgllflglsfg