[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55740.1"

            "ribosome recycling factor"
RRF_STRZT   "RecName: Full=Ribosome-recycling factor;         Short=RRF;AltName: Full=Ribosome-releasing factor;"

OrgPattern -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ----111-----111---------------------------------------------------111-1--1-11---------11-----111111-111111-141211--11--1-11111-1-541-121-1111-111-1---1--1111-1---11-111-1---1121229222212222-214222111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MANVIIEKAKERMTQSHQSLAREFGGIRAGRANASLLDRVHVEYYGVETPLNQIASITIP:Sequence :cHHHHHHHHHHHHHHHHHHHHHHHHTccccccccGGGTccEEEETTEEEEGGGTcEEEcc:Sec Str : ========================================================:RP:SCP|5->184|1dd5A|2e-59|43.3|180/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_STRZT|e-100|100.0|185/185 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->183|PF01765|3e-43|60.6|165/165|RRF 61: . . . * . .: 120 :EARVLLVTPFDKSSLKDIERALNASDLGITPANDGSVIRLVIPALTEETRRDLAKEVKKV:Sequence :cTTEEEEEcccHHHHHHHHHHHcccTTcccEEEETTEEEEEcccccTTHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|5->184|1dd5A|2e-59|43.3|180/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_STRZT|e-100|100.0|185/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->183|PF01765|3e-43|60.6|165/165|RRF 121: . . + . . .: 180 :GENAKVAVRNIRRDAMDEAKKQEKAKEITEDELKTLEKDIQKVTDDAVKHIDDMTANKEK:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|5->184|1dd5A|2e-59|43.3|180/184|d.67.3.1 :============================================================:BL:SWS|1->185|RRF_STRZT|e-100|100.0|185/185 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->183|PF01765|3e-43|60.6|165/165|RRF 181: . * . . . .: 240 :ELLEV :Sequence :HHTcc :Sec Str :==== :RP:SCP|5->184|1dd5A|2e-59|43.3|180/184|d.67.3.1 :===== :BL:SWS|1->185|RRF_STRZT|e-100|100.0|185/185 :$$$ :RP:PFM|19->183|PF01765|3e-43|60.6|165/165|RRF