[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55766.1"

            "histidine kinase TCS07"
            ""

OrgPattern -------------------------------------------------------------------- 149-1----------------1---1------11111111-----1------111--1--111-2221111-------1111----112233-3-----2-4122F1C55----------------------------------1-------------------------------------------1---111121211211121116A4422211-3322221111119*122222222222222122112----------1111----1--1---3334233211222122222222333333333333111---111-674-D1111111112C2224343J31--1142168121-2-233-3B-2152-------------------2---------------------------------------------------------------------2------------------------------22221-----------------------------112---1111-1----121---1-1-13-------------1------11-11111--1-11-2--1-21------------------------1------3211143222-122221111221111-113------1------2233-222223222322-2222223222232222222222221-1111111111111111122221121--211111111111--------------11-1---------------11111-1-1--1---------------------------111122222222221131212-11--------11----------------------------------------11-11-1----5- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------D--------1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRESTQIAQALVENQARI:Sequence : :Sec Str : XXXXXXXXXXXX :SEG|2->13|iiiiasfaills 61: . . . * . .: 120 :EGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDFVTGVAIAFQDYKEVYV:Sequence : :Sec Str : =======:BL:SWS|114->262|ACDG2_METMA|3e-05|33.8|130/470 121: . . + . . .: 180 :STKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTP:Sequence : :Sec Str :============================================================:BL:SWS|114->262|ACDG2_METMA|3e-05|33.8|130/470 181: . * . . . .: 240 :MAVTVTSPFDTEIFHIGETVDKESENWLVGLTSHGYQVQVAVPKNFVLQGTVTSSALIVG:Sequence : :Sec Str :============================================================:BL:SWS|114->262|ACDG2_METMA|3e-05|33.8|130/470 241: + . . . . *: 300 :LSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEXGRRIDISEKDQELLLIAETTN:Sequence : HHHHHHHHHHHHHHHHHHHHHHHHTccHHTcHcTTTTHHHHHHHHHHHHHTT:Sec Str : =======================================:RP:SCP|262->310|2aswA1|6e-05|14.3|49/54|a.274.1.1 :====================== :BL:SWS|114->262|ACDG2_METMA|3e-05|33.8|130/470 : =======================================:BL:SWS|262->529|YESM_BACSU|4e-29|32.8|250/577 301: . . . . + .: 360 :DMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVMQSQDELADII:Sequence :THHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTcccccccc:Sec Str :========== :RP:SCP|262->310|2aswA1|6e-05|14.3|49/54|a.274.1.1 : =====================================================:RP:SCP|308->513|1ya7O1|1e-17|10.3|185/218|a.24.8.1 :============================================================:BL:SWS|262->529|YESM_BACSU|4e-29|32.8|250/577 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|325->397|PF06580|2e-08|38.9|72/82|His_kinase 361: . . . * . .: 420 :YEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT:Sequence :ccccTTcEEEEEHHHHHHHHHHHHHHHHHHHHcccccEEEEEEEcccTTcccEEEEcHHH:Sec Str :============================================================:RP:SCP|308->513|1ya7O1|1e-17|10.3|185/218|a.24.8.1 :============================================================:BL:SWS|262->529|YESM_BACSU|4e-29|32.8|250/577 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|325->397|PF06580|2e-08|38.9|72/82|His_kinase 421: . . + . . .: 480 :LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRY:Sequence :HHHHHHHHHHHHHHHHHHTTTTccEEEEcccEEEEEEEEEEEcccHHHHGcccccccGGG:Sec Str :============================================================:RP:SCP|308->513|1ya7O1|1e-17|10.3|185/218|a.24.8.1 :============================================================:BL:SWS|262->529|YESM_BACSU|4e-29|32.8|250/577 481: . * . . . .: 540 :FEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE :Sequence :GcTTTTccccccccHHHHHHHHHHHTTcEEGGEEEEEETTEEEEEEEEETc :Sec Str :================================= :RP:SCP|308->513|1ya7O1|1e-17|10.3|185/218|a.24.8.1 :================================================= :BL:SWS|262->529|YESM_BACSU|4e-29|32.8|250/577