[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55766.1 spne4 ACF55766.1 "histidine kinase TCS07"
MIIIIASFAILLSYADWDSREKEAQRVAQRVTARTVSEIEYYHRESTQIAQALVENQARI
EGIYKYFSLSMPDYFYWQLERKASPYISVSLYENVDDLYVRNDFVTGVAIAFQDYKEVYV
STKDKRSGEKIRAEDFKPAGNSFAIPVSDPVSDQDLGVIYISLDPAVLYHAIDNTRGHTP
MAVTVTSPFDTEIFHIGETVDKESENWLVGLTSHGYQVQVAVPKNFVLQGTVTSSALIVG
LSLLFIVILYLTLRQTFANYQKQVVDLVESIQVIAQGEXGRRIDISEKDQELLLIAETTN
DMLDRLEKNIHDIYQLELSQKDANMRALQAQINPHFMYNTLEFLRMYAVMQSQDELADII
YEFSSLLRNNISDERETLLKQELEFCRKYSYLCMVRYPKSIAYGFKIDPELENMKIPKFT
LQPLVENYFAHGVDHRRTDNVISIKALKQDGFVEILVVDNGRGMSAEKLANIREKLSQRY
FEHQASYSDQRQSIGIVNVHERFVLYFGDRYAITIESAEQAGVQYRITIQDE
//