[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55806.1"

            "zinc ABC transporter, ATP-binding protein"
ADCC_STRR6  "RecName: Full=Zinc transport system ATP-binding protein adcC;"

OrgPattern MMD6GBEELKLHKHNKYBFGDJFNlMQZWMXMC8BDDAGFFB9ORLQVIMzmX6MYIISKMGFAP166 JPY8*PRRYYYQRPOMNFF-FS88O*FEFFFGTZYaVw*xEUIYScURgTNEgecLFVAAUZZViZiv**NLJIIVPOQJiVW85B79POOH4M9C8--ADKEDHWGRFM77778779686666EMJBKMHFJJSKQZYleCDDjJXRUWUVWQRIIFAFCD9PROUnggIBHCDB8BKBDB7PNNHGXT7IYj***z*x**o***x***sppum***Tbi*zUfloqlkk**QWWYXYWVXXVVWXXRYUXWoYSUjhSLVSafeLMloLPIObUSZXhfihdblhkkdfddbadfbdeSTSSSSTSUTSSTmffTTWhgiaZ*kxuxzx**xybvZjxjjUcca*eXdgmXhOG**aXQTcTPRYRaYFPWSGWTLLGEGGDDUK***OHcuiirlptooqkrnnl*-WbwYUzWlw*MA*************xCEIei*pjqv*ft99999999SGJDDbQf55556444424456785455454466574BA5C8Df**ejoz*z*wfcZbY****haeeSgxt*dklg7EaZUdOYQSlhwr**JXUFM9FPMFFFDEFEJHINPQSm*MTQZVTWdQQXBUONOOOSMLMMIJYeThIFKKBFFGHFB5A6566666AMDDBGFaZjJaNRJPFfLKNQLHHSOLLLGNRPNMU5-AHKII-1-111tg*vQufgkjghhdiff-iffhhdghghjigddfdcby*x**QPRabYYaaaaaaYZaYYWwbaUdddeI2stuwxwvutxxz33EEBCABAGGGFGFre*TTRQQNBLNKKNIMZKNONNEPBHQUPVWUTbjX*cdidZQpw*888789888HYbcrdfeefgmgddEEHDDDDDDF866666EPHHGHFF65444443s9N8765C-68B6B86FEB8BC856777NSeHOXnYbb9NJ -1--FA9-IC47CFD878658A77579AA4545A98496766656655888AE94883596931144321631433414343322312-8967734332451984248CCKDIHVGKC7A6BKHYY5f7z*S3OLREH86U8EbO6D588R64*8OKFXDW*8XFS7bKP*KPJG6877*99B53UCEZ4SK77SJQN6 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKV:Sequence : =========================================================:RP:SCP|4->211|1sgwA|3e-37|25.4|193/200|c.37.1.12 :============================================================:BL:SWS|1->234|ADCC_STRR6|e-138|99.6|234/234 : $$$$$$$$$$$$$$$$$$:RP:PFM|43->166|PF00005|6e-11|35.0|120/123|ABC_tran 61: . . . * . .: 120 :AISKTNTQGKKLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKA:Sequence :============================================================:RP:SCP|4->211|1sgwA|3e-37|25.4|193/200|c.37.1.12 :============================================================:BL:SWS|1->234|ADCC_STRR6|e-138|99.6|234/234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|43->166|PF00005|6e-11|35.0|120/123|ABC_tran 121: . . + . . .: 180 :SLDSVGMWEHRDKRLGSLSGGQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELM:Sequence : ############### :PROS|138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|4->211|1sgwA|3e-37|25.4|193/200|c.37.1.12 :============================================================:BL:SWS|1->234|ADCC_STRR6|e-138|99.6|234/234 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|43->166|PF00005|6e-11|35.0|120/123|ABC_tran 181: . * . . . .: 240 :HHSAHHHGKAVLMITHDPEEVKDYADRNIHLVRNQDSPWRCFNVHENGQEVGHA :Sequence :=============================== :RP:SCP|4->211|1sgwA|3e-37|25.4|193/200|c.37.1.12 :====================================================== :BL:SWS|1->234|ADCC_STRR6|e-138|99.6|234/234