[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55806.1 spne4 ACF55806.1 "zinc ABC transporter, ATP-binding protein"
MRYITVEDLSFYYDKEPVLEHINYCVDSGEFVTLTGENGAAXTTLIKASLGILQPRIGKV
AISKTNTQGKKLRIAYLPQQIASFNAGFPSTVYEFVKSGRYPRKGWFRRLNAHDEEHIKA
SLDSVGMWEHRDKRLGSLSGGQKQRAVIARMFASDPDVFILDEPTTGMDAGSKNEFYELM
HHSAHHHGKAVLMITHDPEEVKDYADRNIHLVRNQDSPWRCFNVHENGQEVGHA
//