[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55904.1"

            "NADP-dependent glyceraldehyde-3-phosphate dehydrogenase"
            ""

OrgPattern 331-1-4754454653-312111-A4432-521-11111111211222124431-1--1-13351--1 7A95M947AAE547KPK9A-9O22Kb99999GSQWSMW**8N7V68781744WKPC9B--DEQ3BENMKKA----111-121H11111--12-211---62637484756--------------12222221221277787---64455334413111113122324555411111111111187856-1-C89999998AAAA99887EDAA6B9AB9HFDF86333332D54555555555555558667711112311111121122-11122---2222111-221111111111122212222222221--111---2-11172223223222-211-2223113131---2211---1--2---1118-6HEEA11111B6GBK546AA7A7FGHIFDHCHGH-45D43I6AOOB-NJJLLLWRNYRREAAC5BHRCAAC8JJEDEEEEEEADC6466911111111----1111-1111-11-11118APcB2CPLDEeZbbZcRLLLHcbcgRQONCOvWwNdWL14GCFE9CB9HENDLP333-112B62444444132BC664413331332223-3333435443333AA15211322211211111111112-11143982894K7DB9AAAAA9AB888997AC9AE-1-5421------C968588CAA9C989CD-ADBDA98D8CA9BCCBCCBJMJ99994CBABBABBBC99C9B9J883667721567688758888--1633122888817DKY222112-----2223LKMHI8H7C9H1KKKKLQPUHTTPPCKHJ3211132122433A566668B88B8999997555------1-441111--------2-2----1---1-12-111-12--111111112-2-2-331 ----CCA-A54-8B8IILKQNQKTTSREECCCCEEDEFEEEEEBDDDDKUUe*nNMGCDDDCD9B6AA4B88C9A894998AA9AC57-IUEICGEFCD9B8GFCF-9MBWOiILONBCDAEKEPQAWCv*Q-SPUCGC9SFGOEAGEDBI88aCFDGOKcWCMFFATBEGAKNC5775*6656ALFcVLJo88VGMKJ -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTRYQNLVNGKWKSSEQEITIYSPINQEELGTVPAMTQTEADEAMQAARAALPXWXALSA:Sequence :TEEEcEEETTEEEccccEEEEEcTTcTTcEEEEEcccHHHHHHHHHHHHHHHHHHTTccH:Sec Str : XXXXXXXXXXXXXXXXXXXX:SEG|41->60|adeamqaaraalpxwxalsa : ==========================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 : ==========================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 61: . . . * . .: 120 :IERAAYLHKTAAILERDKEKIGTILAKEVAKGIKAAIGEVVRTADLIRYAAEEGXRITGQ:Sequence :HHHHHHHHHHHHHHHHTHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHGGGGccc:Sec Str :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 121: . . + . . .: 180 :AMEGGGFEAASKNKLAVVRREPVGIVLAIAPFNYPVNLSASKIAPALIAGNVVMFKPPTQ:Sequence :cccccccccccTTEEEEEEEEEccEEEEEcccccTTHHHHHHHHHHHHTTcEEEEEccGG:Sec Str :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 181: . * . . . .: 240 :GSISGLLLAKAFEEAGIPAGVFNTITGRGSEIGDYIIEHKEVNFINFTGSTPIGERIGRL:Sequence :GHHHHHHHHHHHHHHTccTTcEEEccccTTTHHHHHHHcTTccEEEEEccHHHHHHHHHH:Sec Str :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 241: + . . . . *: 300 :AGMRPIMLELGGKDAALVLEDADLEHAAKQIVAGAFSYSGQRCTAIKRVIVLESVADKLA:Sequence :HTccEEEEEccccEEEEEcTTccHHHHHHHHHHHHHGGGGccTTcEEEEEEEHHHHHHHH:Sec Str : ############ :PROS|276->287|PS00070|ALDEHYDE_DEHYDR_CYS|PDOC00068| : ######## :PROS|248->255|PS00687|ALDEHYDE_DEHYDR_GLU|PDOC00068| :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 301: . . . . + .: 360 :TLLQEEVSKLTVGDPFDNADITPVIDNASADFIWGLIEDAQEKEAQALTPIKREGNLLWP:Sequence :HHHHHHHTTcccccGGGcccccccccHHHHHHHHHHHHHHTTTcEEEEcccccccccccc:Sec Str :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 361: . . . * . .: 420 :VLFDQVTKDMKVAWEEPFGPVLPIIRVASVEEAIAFANESEFGLQSSVFTNDFKKAFEIA:Sequence :EEEEcccTTcGGGTccccccEEEEEEEccHHHHHHHHHccccccEEEEEcccHHHHHHHH:Sec Str :============================================================:RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :============================================================:BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh 421: . . + . . .: 480 :EKLEVGTVHINNKTQRGPDNFPFLGVKGSGAGVQGIKYSIEAMTNVKSIVFDVK :Sequence :HHccccEEEEccccccccTTccccccGGGcccccTcHHHHHTTEEEEEEEEEcc :Sec Str :====================================================== :RP:SCP|3->474|1euhA|e-111|71.6|472/474|c.82.1.1 :====================================================== :BL:SWS|3->474|GAPN_STRMU|0.0|68.6|472/475 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|28->455|PF00171|3e-75|41.9|420/440|Aldedh