[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55940.1"

            "CAAX amino terminal protease family"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1---------------------------------1------------------------1-----111-1111--11111111211----------------111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MEFFDKFHALCFGFLVLIIVITVPYTINHGDFFQNESALIIVSLLVTSLSVAYARKFEMI:Sequence : XXXXXXXXXXXXXXXX :SEG|37->52|saliivsllvtslsva 61: . . . * . .: 120 :SFGMLSKKQLLLFIAIFLLSVLETLVYIHFFAVSSGSGVQHLAEVSRGISLSLILTTSVF:Sequence : =====================================================:BL:SWS|68->203|YVDC_LACLA|1e-07|23.5|136/261 121: . . + . . .: 180 :GPIQEELIFRGLLQGAVFDNSWLGLVLTSSLFSFMHGPSNVPSFIFYLLGGLLLGFAYKK:Sequence : XXXXXXXX :SEG|168->175|llgglllg :============================================================:BL:SWS|68->203|YVDC_LACLA|1e-07|23.5|136/261 181: . * . . . .: 240 :SQNLWVSTLVHMLYNSWPLLYYL :Sequence :======================= :BL:SWS|68->203|YVDC_LACLA|1e-07|23.5|136/261