[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55996.1"

            "primosomal protein N'"
            ""

OrgPattern -------------------------------------------------------------------- 111-12111121211-111-111111111111211111-1--1-111-121111---111-1-1-11111-1------1111-1-31-111111111--11111111111111111111111111113111111111111121211211222122221111211122111121121111221111-2211111111111111111111111111111111111111111111121111111111111111111121211212221111111131111111111111111122212112111111111111111211222111111111111111111111111111111111111111111112111111122112111111121111211111111111121111111-11111111111111111111121111111111111111111111111111111111121111111111111111111111111111111111112222222222222222222222222111111111221112111212211222221111111221222112111111111111211111111111111121111111111121222222222221111112222122212222112222222222221-112221--11122211112222222222-2222122222222222221111111111111111111111111222222121-111111111111--12111112222122221111111111-122111111111122222221221211112122111111111211112222222111222222222211111111111111111112111111111---------------------1122211132211 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------113-1---1---- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSD:Sequence :ccccccccccccccccccccccccTTccTcccTTcEEEEEETTTEEEEEEEccccccccc:Sec Str :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 61: . . . * . .: 120 :GEEMEQDLKDIAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKIL:Sequence :ccGGGGccccccEEccccccccHHHHHHHHHHHHHTTccHHHHHHHHHHHHH :Sec Str :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 121: . . + . . .: 180 :YPLEGLSQEERVRLFGSEDSLAFSSLDLGKQAEMMRLTRKGLLGLEYQAVDQKKVKTQSW:Sequence : :Sec Str :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 181: . * . . . .: 240 :YEVDHAQLEGVEISTRAKKKLELRDYLLSHPESASLASLLESYSREQVNFFVDQGAVTIV:Sequence : cccHHHHHHHHHTTEEEc:Sec Str : XXXXXXXXXXXXXXXX :SEG|207->222|llshpesaslaslles :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 241: + . . . . *: 300 :QKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQ:Sequence :ccccccHHcccccccccGGGccccHHHHHHHHHHHHHHHTccEEEEEccTTccHHHHHHH:Sec Str : ==============================================:RP:SCP|255->436|2eyqA3|1e-43|29.1|172/233|c.37.1.19 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 : $$$$$$$$$$$$$$$$:RP:PFM|285->385|PF00270|1e-05|35.1|97/167|DEAD 301: . . . . + .: 360 :IIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGD:Sequence :HHHHHHHHHTTHHHHHHHHHEEcccccTTEEccEEEEEEcTTccEEEEEEEEEcccGGGG:Sec Str :============================================================:RP:SCP|255->436|2eyqA3|1e-43|29.1|172/233|c.37.1.19 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|285->385|PF00270|1e-05|35.1|97/167|DEAD 361: . . . * . .: 420 :AQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS:Sequence :TcccTTccccHHHHHHHHHccTcccTTTcTTcTTcccccccccHHHHHHHHHHHHHHHTc:Sec Str :============================================================:RP:SCP|255->436|2eyqA3|1e-43|29.1|172/233|c.37.1.19 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 :$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|285->385|PF00270|1e-05|35.1|97/167|DEAD 421: . . + . . .: 480 :ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQ:Sequence :cHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHTccHHHHHHHHHcHHH:Sec Str :================ :RP:SCP|255->436|2eyqA3|1e-43|29.1|172/233|c.37.1.19 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 481: . * . . . .: 540 :DRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDI:Sequence :HHHHTHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str : ========================================================:RP:SCP|485->610|1dzfA1|1e-36|8.9|124/139|c.52.3.1 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 541: + . . . . *: 600 :PQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGE:Sequence :HHHHHHHTTcccccccccHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHTTTTE:Sec Str :============================================================:RP:SCP|485->610|1dzfA1|1e-36|8.9|124/139|c.52.3.1 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 : $$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|574->657|PF00271|3e-06|38.6|70/76|Helicase_C 601: . . . . + .: 660 :ADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG:Sequence :EEEEEcTTHHHHHHccccHHHHHHHHTcccHHHHHHTcccHHHHHHHHHHHTcEEEEEEE:Sec Str :========== :RP:SCP|485->610|1dzfA1|1e-36|8.9|124/139|c.52.3.1 :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|574->657|PF00271|3e-06|38.6|70/76|Helicase_C 661: . . . * . .: 720 :QVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKR:Sequence :EcccccccTTcccHHHHHcHHHHHTTHHHHHHHHHHcccEEEEHHccccEEccHHHHHHH:Sec Str :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 721: . . + . . .: 780 :AYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQE:Sequence :HHHHHHHHHTTEEcccHHHHHHHTcEEccccEETTEEEEcTTcccHHHHHHHHHHHHHHc:Sec Str :============================================================:BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805 781: . * . . . .: 840 :RENSELRLSIDHEPQQFL :Sequence :HHTcHH :Sec Str :================== :BL:SWS|1->798|PRIA_BACSU|0.0|45.4|793/805