[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55996.1 spne4 ACF55996.1 "primosomal protein N'"
MALAKIIVDVPLMQTDQPYSYRIPEEFEGMLEVGMRVHVPFGKGNRLIQGIVLGLESQSD
GEEMEQDLKDIAEVLDFSPVLTPEQLWLAEELRKSVFSYKISILKAMLPGFLNSSYDKIL
YPLEGLSQEERVRLFGSEDSLAFSSLDLGKQAEMMRLTRKGLLGLEYQAVDQKKVKTQSW
YEVDHAQLEGVEISTRAKKKLELRDYLLSHPESASLASLLESYSREQVNFFVDQGAVTIV
QKEVRRSAAYFEGIEASRPLELNPEQRQARDAVVSSIGSSQPPFLLQGITGSGKTEVYLQ
IIQGALDKGKTAILLVPEISLTPQMTERFIARFGDKVAILHSGLSNGEKYDEWRKVERGD
AQVVVGARSAIFAPLKNLGVMIIDEEHEAAYKQDSNPRYHAREVAILRAQYNQATLVLGS
ATPSLESRARAGKGVYQHLRLTQRANPLATIPEVQVIDFRDYIGQNETSNFTPPLLEAIQ
DRLVKKEQVVLMLNRRGYSSFVMCRECGTVDTCPNCDISLTLHMDTKTMNCHYCGFSKDI
PQVCPNCKSRSIRYYGTGTQKAYDELAELFPQARILRMDVDTTRKKGSHQALLDQFGRGE
ADILLGTQMIAKGLDFPNVTLVGVLNADTALNLPDFRSSERTFQLLTQVAGRAGRAEKAG
QVLIQSYNSQHYAIRFAKDQDYEGFYAYEMGIRRQLGYPPYYFTIGITLSHKKEEEVFKR
AYEVMNILRSGLSETSPILGPTPKPIARTHNLYHYQILIKYRLEDELGPTLNQVLALTQE
RENSELRLSIDHEPQQFL
//