[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF55997.1"

            "type II restriction-modification system regulatory protein, putative"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-11111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITNGFK :Sequence :ccHHHHHHccEEEEHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTccEEHH :Sec Str : ========================================= :RP:SCP|9->49|1d1lA|5e-08|29.3|41/61|a.35.1.2 : ======================================== :BL:SWS|10->49|CEBA_BACAM|1e-04|35.0|40/102 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->47|PF01381|8e-04|45.7|35/55|HTH_3