[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF55997.1 spne4 ACF55997.1 "type II restriction-modification system regulatory protein, putative"
MNMINVCDVGKRIKELRISSNLTQDKIAEYLSLNQSMIAKMEKGERNITNGFK
//