[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56022.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------111-----1-------------11----------------------------------------------1--------------111-----------1--1111-1112------------------------------------------------------------------------------------------1-----1111111111111111111111111111111111111---1111------------------------------------------------------------------1------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------1---------1--1111--11--111------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MNEIKCPNCGEVFTVNESQYAELLSQVRTTEFDKELHDRMRQELALAEQKAMNEQQTKLA:Sequence : HHHHHHHHHTHHH HHHHHHHHHHHHHHHHH:Sec Str : ===============================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->168|PF12128|2e-05|19.9|156/1179|DUF3584 61: . . . * . .: 120 :QKDQEIAQLQSQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQL:Sequence :HHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH:Sec Str :============================================================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|13->168|PF12128|2e-05|19.9|156/1179|DUF3584 121: . . + . . .: 180 :QKTLSDLEKERNQVKNQLLLQEKENELSLASVKQNYEAQLKAASEQVEFYKNFKAQQSTK:Sequence :HTTTTHHHHHHHH :Sec Str : XXXXXXXXXXXXX :SEG|135->147|knqlllqekenel :============================================================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|13->168|PF12128|2e-05|19.9|156/1179|DUF3584 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|152->414|PF09903|9e-68|70.3|256/263|DUF2130 181: . * . . . .: 240 :AIGESLEQYAESEFNKVRSFAFPNAYFEKDNKVSSRGSKGDFIFRECDENGVEIISIMFE:Sequence : :Sec Str :============================================================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|152->414|PF09903|9e-68|70.3|256/263|DUF2130 241: + . . . . *: 300 :MKNEADGTEKKHKNADFYKELDKDRREKNCEYAVLVTMLEADNDYFNTGIVDVSHEYEKM:Sequence : cccEEEEEEccGGHHHHHHHHHHHHTccE:Sec Str :============================================================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|152->414|PF09903|9e-68|70.3|256/263|DUF2130 301: . . . . + .: 360 :YVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFKLAFAKNYNSA:Sequence :EEEEEEccccHHHHTHHHHHHTTTcEEEEEEEcGGGHHHHHHHHHHTTccccEEEEEcGG:Sec Str :============================================================:BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|152->414|PF09903|9e-68|70.3|256/263|DUF2130 361: . . . * . .: 420 :STNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLEDVSVKKLTRKNPTMKAKFEA:Sequence :GHHHHHHHHTccHHHHTHHHHHHHHHHHHHHHHHHHHHHH :Sec Str :=============================================== :BL:SWS|30->407|Y161_MYCPN|3e-16|31.8|343/445 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|152->414|PF09903|9e-68|70.3|256/263|DUF2130 421: . . + . . .: 480 :LKGE :Sequence : :Sec Str