[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56022.1 spne4 ACF56022.1 "conserved hypothetical protein"
MNEIKCPNCGEVFTVNESQYAELLSQVRTTEFDKELHDRMRQELALAEQKAMNEQQTKLA
QKDQEIAQLQSQIQNFDTEKELAKKEVEQTSHQALLAKDKEVQALENQLATLRLEHENQL
QKTLSDLEKERNQVKNQLLLQEKENELSLASVKQNYEAQLKAASEQVEFYKNFKAQQSTK
AIGESLEQYAESEFNKVRSFAFPNAYFEKDNKVSSRGSKGDFIFRECDENGVEIISIMFE
MKNEADGTEKKHKNADFYKELDKDRREKNCEYAVLVTMLEADNDYFNTGIVDVSHEYEKM
YVVRPQFFIQLIGLLRNAALNSLKYKQELALVREQNIDITHFEEDLDAFKLAFAKNYNSA
STNFGKAIDEIDKAIKRMEEVKKFLTTSENQLRLANNKLEDVSVKKLTRKNPTMKAKFEA
LKGE
//