[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56087.1"

            "ribosome small subunit-dependent GTPase A"
RSGA_STRR6  "RecName: Full=Putative ribosome biogenesis GTPase rsgA;         EC=3.6.1.-;"

OrgPattern ----------------------------------------------11--111--------------- --1-111111111111112-11111111111111112222111122112111232111--22-12122231-------1121-2-1--11211111---11111111211--------------11112211122111111---1121111111111111111111212111111111111111-------111222222221222222112211222111222222222222111111111111111111111121111111122111111111-11111111111111111111111111111111112111111111111112111111111111121111113121111111222211211111111111-11--1-----------------1------------11-11----1-----1---11-----1---1--1----1---------------------------------------------------1111111111111111111111111111111111111111111111111111111121111111111111111111-11-1211--2-2211111111-11-------------------------1---111111111111111111211111122121--1-1-1------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11-----11111111311111111111111111111111111111111111111111111111111111222231111122222111111111111111121111222111111112-111111-11111111111111111111211111111-11 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-------1--1117111-111-2-22------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHE:Sequence : EEEEEEEETTEEEEccccEEEEEEccccccccccccccTcEEEEEccTTccEEEEEccc:Sec Str :============================================================:RP:SCP|1->62|1u0lA1|6e-13|29.0|62/66|b.40.4.5 :============================================================:BL:SWS|1->292|RSGA_STRR6|e-169|99.0|292/292 61: . . . * . .: 120 :RKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRG:Sequence :cTTHHHHHHHTTccEEEEEEETTcTHHHHHHHHHHHHHHHHHTcEEEEEEEEEcTTccEE:Sec Str :== :RP:SCP|1->62|1u0lA1|6e-13|29.0|62/66|b.40.4.5 : ==========================================================:RP:SCP|63->283|1t9hA2|2e-12|38.7|212/212|c.37.1.8 :============================================================:BL:SWS|1->292|RSGA_STRR6|e-169|99.0|292/292 121: . . + . . .: 180 :ELDFYRQTYGDIGYDFVTSKEELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEI:Sequence :EEEEEEEcTTHHHHHcHHHGGGccEEEEEEccccccccccEEEEEEEEEEGGEEEEEEcc:Sec Str :============================================================:RP:SCP|63->283|1t9hA2|2e-12|38.7|212/212|c.37.1.8 :============================================================:BL:SWS|1->292|RSGA_STRR6|e-169|99.0|292/292 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|127->273|PF03193|7e-43|58.5|147/160|DUF258 181: . * . . . .: 240 :SDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFR:Sequence :ccccHHHHHcccEEEEEETTTTEEEEEcccccccccHHHHHHHHHHHGGEEETTcHHHHH:Sec Str :============================================================:RP:SCP|63->283|1t9hA2|2e-12|38.7|212/212|c.37.1.8 :============================================================:BL:SWS|1->292|RSGA_STRR6|e-169|99.0|292/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|127->273|PF03193|7e-43|58.5|147/160|DUF258 241: + . . . . *: 300 :TCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRRETYKKVSKKIPK :Sequence :THHHHHHHHHHHHTTccEEEEcHHHHHHHHHHHHHHHTTcccc :Sec Str :=========================================== :RP:SCP|63->283|1t9hA2|2e-12|38.7|212/212|c.37.1.8 :==================================================== :BL:SWS|1->292|RSGA_STRR6|e-169|99.0|292/292 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|127->273|PF03193|7e-43|58.5|147/160|DUF258