[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56087.1 spne4 ACF56087.1 "ribosome small subunit-dependent GTPase A"
MQGQIIKALAGFYYVESDGQVYQTRARGNFRKKGHTPYVGDWVDFSAEENSEGYILKIHE
RKNSLVRPPIVNIDQAVVIMSVKEPDFNSNLLDRFLVLLEHKGIHPIVYISKMDLLEDRG
ELDFYRQTYGDIGYDFVTSKEELLSLLTGKVTVFMGQTGVGKSTLLNKLVPDLNLETGEI
SDSLGRGRHTTRAVSFYNLNGGKIADTPGFSSLDYEVSRAEDLNQAFPEIATVSRDCKFR
TCTHTHEPSCAVKPAVEEGVIATFRFDNYLQFLSEIENRRETYKKVSKKIPK
//