[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56117.1 spne4 ACF56117.1 "conserved hypothetical protein"
MKKTVYKKLGISIIASTLLASQLSTVSALSVISSTGEEYEVSETLEKGPGSNDSSLSEIS
PTYGSYYQKQSEVLSVMMI
//