[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56119.1"

            "CrcB protein"
CRCB1_STRPN  "RecName: Full=Protein crcB homolog 1;"

OrgPattern ---1---------------------------------------------------------------- --------------1----------------------1-1--------------------------------111-------------11-1-------11-1------------------------111111111----------------------------------------------------------111111111111111------1-1-11----111111---11111111-1111111112-1-1--1--11--1-------------------1--11111111111-------------1-------------1-------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------1--------------------11----------------------------------------1-111111---------------------------111-----------------------11-1--111-11111-11-111111111111-111--1-----1111111111111111-1111111--111111111111---------------1-----1-----------11-1111---1------1-----------------------------------------------------------------------------------------------------------1 --------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAIL:Sequence :============================================================:BL:SWS|1->109|CRCB1_STRPN|4e-59|100.0|109/109 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->107|PF02537|6e-06|41.0|105/115|CRCB 61: . . . * . .: 120 :ATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL :Sequence :================================================= :BL:SWS|1->109|CRCB1_STRPN|4e-59|100.0|109/109 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|3->107|PF02537|6e-06|41.0|105/115|CRCB