[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56119.1 spne4 ACF56119.1 "CrcB protein"
MVIVYLAIACGLGALVRYFFSRYNQASKLPLGTLIANLLGCFLIGVFYNHVESKEVYAIL
ATGFCGGLTTFSTLNDELQRLLSDKKVFYSYLTLTYIGGLVAIFLGILL
//