[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56127.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---1-1111111111----------1-------1-1-11--------11---1111----111-1-1111--------11111--------------------------------------------------------1111111-------------------------------------1111111--11111111111111111111111111111111122222211111111111111111111111111111111111111111111121211111111111111111111111111111111111111111111111111111111111-111111111-11111-111-1-1111-1111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--1111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1111-----------------------------------------------------------------------------------------------------------211111-1111111---1111111111111111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSKITTSLFQEMVQAASTRLNKQAEYVNSLNVFPVPDGDTGTNMGMTIENGAKEVADKPA:Sequence : ccHHHHHHHHHHHHHHHHHTHHHHHHHTTHTTccccHHHHHHHHHHHHHHHcccccH:Sec Str : =========================================================:RP:SCP|4->201|3cr3A1|2e-42|18.8|181/192|a.208.1.1 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 : $$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->195|PF02734|1e-24|45.9|159/173|Dak2 61: . . . * . .: 120 :STVGEVASILAKGLLMGARGNSGVITSQLFRGFSQAIKDKDELTGQDLALAFQSGVEVAY:Sequence :ccHHHHHHHHHHHHHHHcccTHHHHHHHHHHHHHHTcccccHTTcccHHHHHHHHHHHHH:Sec Str :============================================================:RP:SCP|4->201|3cr3A1|2e-42|18.8|181/192|a.208.1.1 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->195|PF02734|1e-24|45.9|159/173|Dak2 121: . . + . . .: 180 :KAVMKPVEGTILTVSRGAAIGAKKKAEQTDDTVEVMRAALEGAKTALAKTPDMLPVLKEV:Sequence :HHcccTTcccHHHHHHHHHHHHHHHHHTTcHHHHTTcccHHHHHHHHHHGGGcccccGGT:Sec Str :============================================================:RP:SCP|4->201|3cr3A1|2e-42|18.8|181/192|a.208.1.1 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|35->195|PF02734|1e-24|45.9|159/173|Dak2 181: . * . . . .: 240 :GVVDSGGQGLVFIYEGFLSALTGEYIASEDFVATPANMSEMINVEHHKSVAGHVATEDIT:Sequence :TcccHHHHHHHHHHHHHHHHH :Sec Str :===================== :RP:SCP|4->201|3cr3A1|2e-42|18.8|181/192|a.208.1.1 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 :$$$$$$$$$$$$$$$ :RP:PFM|35->195|PF02734|1e-24|45.9|159/173|Dak2 241: + . . . . *: 300 :FGYCTEIMVALKQGPTYAKDFDYDEFRNYLDELGDSLLVVNDDEIVKVHVHTEDPGLVMQ:Sequence : HHHcTTTTccTTcccc:Sec Str :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 301: . . . . + .: 360 :EGLKYGSLVKVKVDNMRNQHEAQVEKEATQVIKSAEEKEYALIAVVAGKGLADIFCSQGV:Sequence :ccHHHHHHHHHHHHHHHHHHHHHHTTTTcEEEccEEEcccEEEEEEHHHHHHHHHHTTcc:Sec Str : =====================:RP:SCP|340->448|3cr3C1|1e-07|13.8|109/121|c.54.1.2 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 361: . . . * . .: 420 :DYVIEGGQTMNPSTEDFIKAVEQVNARNIIFLPNNKNXFMAAQSAAEVLEQPAVVVEART:Sequence :ccEEETTccccccHHHHHHHHHHccccEEEEEEccGGGHHHHHHHHHHcccEEEEccccH:Sec Str :============================================================:RP:SCP|340->448|3cr3C1|1e-07|13.8|109/121|c.54.1.2 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 421: . . + . . .: 480 :LPQGMTSLLAFDPSKSIEENQERMTAALSDVVSGSVTTAVRDTTIDGLEIHENDNLGMVD:Sequence :HHHHHHHHHHHHHTccHHHHHHHHHTTccccccccccEEcccGGGTTTcTTcEEEEEEET:Sec Str :============================ :RP:SCP|340->448|3cr3C1|1e-07|13.8|109/121|c.54.1.2 :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 481: . * . . . .: 540 :GKILVSNPDMHQTLTETLKHMLDEDSEIVTFYVGEDGSEELANEIAQEIVEEFEDVEVEI:Sequence :TEEEEEEHHHHHHHHHHHHHHHTTcccEEEEEEEcccTHHHHHHHHHHHHccccEEEEEE:Sec Str : XXXXXXXXXXXXX:SEG|528->540|eiveefedvevei :============================================================:BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552 541: + . . . . *: 600 :HQGQQPVYPYLFSVE :Sequence :EEccHHHHHHH :Sec Str :=============== :BL:SWS|1->555|Y1689_STAHJ|e-147|48.8|547/552