[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56217.1"

            "ABC transporter, ATP-binding/permease protein"
            ""

OrgPattern KJD4FBEFNMMKMJMIZDDB9DBQlKOXZKaKH6DBB9ECEA9NSOPcIP*va8JTIHRHIGD9K177 NPdC*RRTddcQWIPMLII-IQ88TwIIIIILWXYYk***GkMwYoiZhQNJlloGKYAAYeWSzWj***WTUTTkXVfM*aQB8DADRRMH4J8BJ--EDPKFIVMWMM43543438896666DRJENVIJRPVNUbbkmJIGwIgdgeVWcOQNPOEIGMFVWPdu**SGPFJEGENGIFBLHQBBif9VVq********t**********w****Qgo**hhwwwtuu**YbceefcYdcccbdbWYQTW*oVe**fNkYrurNO**bUQWhfcijmmqvrmuxwxsvtqomrxotqYbXWYZaadaaYY*ongfgpprmi*t*********f*hk***Wdda*jevwvhjME**ocQbceLQjZkiKYXNDPKKKLHJHFKUL***RMZxqo*hososrotkjp*-Yb*YUuYq**OA*************vFHKky*rmrw*xvPOPPPPPPZLQCIVQo665575557679679A79987877895A5ECCHBAj*tdvjqsquneedfbmm**mhljRkpm*lpyc6EZaYhOPVVhi*s**RVUDQFNYLEHFEHDGMMKNURTj*LYPbWKUhONZEXUROQUVOVGGLFdbShIDHLEFFGHIC787888898IHFDHIGceiKcKTFMInKRTUQJOPRPQPOVWURTS3-GFLGF322222*g*yPqdgonohmnnff-mgffigkiljnokddfedf*****gjdbfZcceeefecaeaca*aYaeedfM5rx*z***y*y*z33GDCFCCDLLOMHBtY*USTYUSEOQNKPKPbIKMKKDQEHNcWfgZiiul*dhnfeUuxyDDBBBECADHbhgvfgggfrtqqrIHNEIFEHHJBBBB64HQMLBCCE45434545*7XD9ABA-AAB9DD8GGEBBIBB8BBAQVlPKc*ghc9LI 6777uoO-kKC7XebLQRJNRWTjVlRKKEGFGUVQIQPOPLKFGFVQSfbelhSPWNNLKMLHJADC2JD7KFKEF2GJ9FEDKP7A-ZkFQRTRIHHMGAMbaQ6R*s*hqd*p*QLQNQfN**N*K**x2*a*SPQMoOU*kIUMOGjLH*QgZcsRw*Z*ZcU*gm*tk*eGNKF*CDCNL*np*L**JM****b ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSL:Sequence : XXXXXXXXXXX:SEG|50->65|qltqqdlllslfylll : ==========================================================:RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 : ===========================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->288|PF00664|2e-29|31.2|266/274|ABC_membrane 61: . . . * . .: 120 :FYLLLAAFGMYYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHA:Sequence :XXXXX :SEG|50->65|qltqqdlllslfylll :============================================================:RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->288|PF00664|2e-29|31.2|266/274|ABC_membrane 121: . . + . . .: 180 :TNDINALTRLAGGGVMSAVDASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGR:Sequence :============================================================:RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->288|PF00664|2e-29|31.2|266/274|ABC_membrane 181: . * . . . .: 240 :KTHKAFGESQAAFSELNNKVQESVSGIKVTKSFGYQADELKSFQAVNELTFQKNLQTMKY:Sequence :============================================================:RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|19->288|PF00664|2e-29|31.2|266/274|ABC_membrane 241: + . . . . *: 300 :DSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTFISYLDMLVWPLMAIGFLFNT:Sequence :============================================================:RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|19->288|PF00664|2e-29|31.2|266/274|ABC_membrane 301: . . . . + .: 360 :TQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEETLTDIHFSLAK:Sequence :=================== :RP:SCP|3->319|2hydA2|4e-58|22.2|316/323|f.37.1.1 : ===================:RP:SCP|342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 : $:RP:PFM|360->392|PF03193|4e-04|48.5|33/160|DUF258 361: . . . * . .: 420 :GQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL:Sequence :============================================================:RP:SCP|342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|360->392|PF03193|4e-04|48.5|33/160|DUF258 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|375->500|PF00005|2e-09|35.8|120/123|ABC_tran 421: . . + . . .: 480 :FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRL:Sequence : #########:PROS|472->486|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|375->500|PF00005|2e-09|35.8|120/123|ABC_tran 481: . * . . . .: 540 :AMSRAMILEPDILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLIL:Sequence :###### :PROS|472->486|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12 :============================================================:BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585 :$$$$$$$$$$$$$$$$$$$$ :RP:PFM|375->500|PF00005|2e-09|35.8|120/123|ABC_tran 541: + . . . . *: 600 :VLQNGQIIERGRHEDLLALDGWYAQTYQSQQLEMKGEEDAE :Sequence :========================================= :RP:SCP|342->581|1q3hA|3e-37|23.9|226/265|c.37.1.12 :================================ :BL:SWS|2->572|YHEI_BACSU|e-139|43.6|571/585