[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56217.1 spne4 ACF56217.1 "ABC transporter, ATP-binding/permease protein"
MSIIQKLWWFFKLEKRRYLVGIVALILVSVLNLIPPMVMGRVIDAITSGQLTQQDLLLSL
FYLLLAAFGMYYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHA
TNDINALTRLAGGGVMSAVDASITALVTLLTMLFSISWQMTLVAILPLPFMAYTTSRLGR
KTHKAFGESQAAFSELNNKVQESVSGIKVTKSFGYQADELKSFQAVNELTFQKNLQTMKY
DSLFDPMVLLFVGSSYVLTLLVGSLMVQEGQITVGNLVTFISYLDMLVWPLMAIGFLFNT
TQRGKVSYQRIENLLSQESPVQDPEFPLDGIENGRLEYAIDSFAFENEETLTDIHFSLAK
GQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIXLNGHDIRDYRLTDLRSLMGYVPQDQFL
FATSILDNIRFGNPNLPLSAVVEATKLARVYQDIVDMPQGFDTLIGEKGVSLSGGQKQRL
AMSRAMILEPDILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLIL
VLQNGQIIERGRHEDLLALDGWYAQTYQSQQLEMKGEEDAE
//