[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56337.1"

            "transcriptional regulator, RpiR family"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------1-------------------1-----------1--1--1-11--11-------1--------------------------------------------------------------------------------------------------------11---11---111111222211122143224-1122-11-1312211131-111111111111112--2-2-------1-211--22214---4331111111111211222121211111111111111122---222221-1411-1111-1--2---2231--2----------------1-21--1--------------1----------------------------------1--2------1---11---1--------------------------------------------------------------1222222112223212222222221-1----11-1--11-111--1------1-1111111-----------------------------------------------------------------1-2-----1----------------------------------21--3--2--22222----221223-21-2-1121131-1----313222222112212222---1-----222122222222------------------111-11111111121---------------------------------------33312212222233-1--------------------------------1---------------------1----111-111-1--- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MLLQKELIPMIEANLPNMAYAEKDIAKFFLKQQPLNDYSSKALCEYLNVSKATLTRFAKK:Sequence : HHHHHHcTTHHHHTEEEEEccccEEEEEcTTccccHHHHHHHTTHHHHHHHHHTTc:Sec Str : ======================================================:RP:SCP|7->69|2o3fA1|2e-10|19.0|63/83|a.4.1.20 : =========================================================:BL:SWS|4->252|Y189_CLOPE|4e-19|26.3|232/279 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|11->101|PF01418|2e-05|33.0|91/102|HTH_6 61: . . . * . .: 120 :CGFKGFRQFIFKYQEMIHEKEKLALYTEATEKVLSDYEEMLRKTYTVLDEVQLERIAEMI:Sequence :cccTTTTcccHHHHTcTTccccEETTEEcHHHHHHTTHHHHHHHHHHHHHHHHHHHTTcT:Sec Str :========= :RP:SCP|7->69|2o3fA1|2e-10|19.0|63/83|a.4.1.20 : ==========================:RP:SCP|95->204|1j5xA|2e-15|18.2|110/319|c.80.1.1 :============================================================:BL:SWS|4->252|Y189_CLOPE|4e-19|26.3|232/279 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|11->101|PF01418|2e-05|33.0|91/102|HTH_6 121: . . + . . .: 180 :ETAERVYLYGKGSSVLALQEMKMRFMRLGVIGEVLSDEDMILWSSLLLNENCLVIGASIS:Sequence :TcccEEEEEEcHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHccccTTccEEEEEccc:Sec Str :============================================================:RP:SCP|95->204|1j5xA|2e-15|18.2|110/319|c.80.1.1 :============================================================:BL:SWS|4->252|Y189_CLOPE|4e-19|26.3|232/279 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|123->204|PF01380|1e-05|32.9|82/131|SIS 181: . * . . . .: 240 :GQTDIVLEGLQKAADKGAKTVLMTTRKFDEEDCFFDELLLLASTDHLSYGNRISPQFPIL:Sequence :cccHHHHHHHHHHHHccccEEEEEccT :Sec Str : XXXXXXXXXXXXXX :SEG|208->221|fdeedcffdellll :======================== :RP:SCP|95->204|1j5xA|2e-15|18.2|110/319|c.80.1.1 :============================================================:BL:SWS|4->252|Y189_CLOPE|4e-19|26.3|232/279 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|123->204|PF01380|1e-05|32.9|82/131|SIS 241: + . . . . *: 300 :LITDCLFSNYLESPERQYYYNQTIIHKEE :Sequence : :Sec Str :============ :BL:SWS|4->252|Y189_CLOPE|4e-19|26.3|232/279