[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56378.1"

            "ABC transporter, ATP-binding protein"
            ""

OrgPattern RQLATLIGQQQMSMVPjINNJNNZuLPdlThTKEEDECIHIFCTWSUjNR**f8ObLUWMQJJCX18A UboK*gedqqtXYTVPRNM-MjAAW*NNNNNOupnrt***S*O*o*pYrieP**zNRiBCqv*j*mw***eeZYY*cafP*hiBCDBDYXZT6TILL-1KIZNOOiSeOa99999999BCAAAAKUQOWcSOXVcVlrrz*PON*XuhpugfpaeTUOKNJMJehbn***cJSJNKKLQHNJJdYbPNphBVg*************************hq***rt***zy***dlmonollmnlllmmdkdhh*mch**gSham**QR**ZXSbomllnvvz*yt**zzx*xxusy*vxweeedcehgiffdd*usihivuxqu***********l*ot***glni**j***otVK**uqYejpTZnhqqPfZXNgUUULMONMRiX***eWy****************-ov*ki*o***SF**************KMM**********VUVVVVVVzbfLRlY*76577666668AC8EF8CED9AAAB97A6LFEFEH************yy*u********l********DS**x*mupv******ZrqObOVraLNKKMKKVRPeuqh**UlW*oVhvebmLjfdUWYhWcXbWZq*a*RMOUIRPQRPJAEDCDEECDHYHHNONtt*UzagNWN*XYbcZRZjYXWabZgccff5-EKQSO321444****Z************-*************z**********stmpsnpqqrprpnoropo*ystzzz*X4************43KKEHEEFMPRORO*r*cdcdcaLRUPNWTXkOQSQQHVJQVvh**zy*********j***HHHGHHHGHOnus*vwwww*****TRPOPPOMOOCBBBA9QWUTMMLNAA988988*DYDABDF-DDDCEDCRQN8BNBGB889boxVVm*qpnGeO 2145liJ-WKC8MWLFAHE9HLGLAMEFFAB8AJGG9DBBECB999EDGJKGQLGEIAABCCA4C5662485BB9773777AA7AE35-DI8AE9E99B965AOIOBSajeWbTkdVHDEBGVLrjAwA**i2iPgHCD7eAJcV9MDEAZCB*EWQPsFc*KpPgA*be*XiVIFGFD*IFGKO*nu*E**HH*t*xO ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR:Sequence :============================================================:RP:SCP|1->208|1b0uA|8e-38|28.8|208/258|c.37.1.12 :============================================================:BL:SWS|1->203|MACB_CAMJR|3e-33|37.1|202/641 : $$$$$$$$$$$$$$$$$$$$:RP:PFM|41->163|PF00005|7e-13|35.6|118/123|ABC_tran 61: . . . * . .: 120 :GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ:Sequence :============================================================:RP:SCP|1->208|1b0uA|8e-38|28.8|208/258|c.37.1.12 :============================================================:BL:SWS|1->203|MACB_CAMJR|3e-33|37.1|202/641 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|41->163|PF00005|7e-13|35.6|118/123|ABC_tran 121: . . + . . .: 180 :VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL:Sequence : ####### :PROS|149->155|PS00092|N6_MTASE|PDOC00087| : ############### :PROS|135->149|PS00211|ABC_TRANSPORTER_1|PDOC00185| :============================================================:RP:SCP|1->208|1b0uA|8e-38|28.8|208/258|c.37.1.12 :============================================================:BL:SWS|1->203|MACB_CAMJR|3e-33|37.1|202/641 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|41->163|PF00005|7e-13|35.6|118/123|ABC_tran : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|135->204|PF02463|9e-05|39.1|69/536|SMC_N 181: . * . . . .: 240 :RDDNRLIIIATHNPAIWEMADEVFTMDHLK :Sequence :============================ :RP:SCP|1->208|1b0uA|8e-38|28.8|208/258|c.37.1.12 :======================= :BL:SWS|1->203|MACB_CAMJR|3e-33|37.1|202/641 :$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|135->204|PF02463|9e-05|39.1|69/536|SMC_N