[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56378.1 spne4 ACF56378.1 "ABC transporter, ATP-binding protein"
MIELKQVSKSFGERELFSNLSMTFEAGKVYALIGSSGSGKTTLMNMIGKLEPYDGTIFYR
GKDLANYKSSDFFRHELGYLFQNFGLIENQSIEENLKLGLIGQKLSRSEQRLRQKQALEQ
VGLAYLDLDKRIFELSGGESQRVALAKIILKNPPFILADEPTASIDPATSQLIMEILLSL
RDDNRLIIIATHNPAIWEMADEVFTMDHLK
//