[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56413.1"

            "ribosomal small subunit pseudouridine synthase A"
            ""

OrgPattern -------------------------------------------------------------------- 1221111111111111111-11111111111111111111111111111111111111--11111111111-1111111111122222111111-11--21333143412-1111111-11111111111111111111111111122122222222222122122122221211111211111112222-222-4444444344444422222244422232332222223332222222222222222222-21322312222211222222213333333333322333333333333333333333333333333333323324222222242422223344232222221111121111222222-22211333311111121111111111111111111111-3322222212112111222222221144121111112211111111111111312------------1111111111111-----1212-2222243343444444444344444444444443333333344443222444454444334333322244421113111111111111111121111113111211111111111111111112111233442355624545666677755556-77577--2111211-11143333444444444444-4444444444444444444444333344444444444444443544434442-433343333444--2211111222224234333333333333323333333344333333333333-3333333111111111354464444444544555666644422221112221111111111112-311111-21111--1111---12---2212221222133 11--22--31--------------------------------------------------------------------------------------------------82-----------------------------------------------------2---------1-1-24C4431111-1-114342222 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEF:Sequence :EEHHHHHHTTTcccHHHHHHHHHTTcEEETTEEccTTcEEcccccEEETTEEEccccGGc:Sec Str :========================================================= :RP:SCP|1->57|1vioA2|2e-13|32.1|56/58|d.66.1.5 :============================================================:BL:SWS|1->232|RSUA_YERPE|6e-42|43.0|221/235 61: . . . * . .: 120 :VYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAH:Sequence :cEEEEEEcTTcccccccccTTcHHHHHHHHTcccccEEccccccccEEEEEEEccTHHHH:Sec Str : ############### :PROS|100->114|PS01149|PSI_RSU|PDOC00885| :============================================================:RP:SCP|61->235|1kskA4|1e-39|41.1|168/172|d.265.1.3 :============================================================:BL:SWS|1->232|RSUA_YERPE|6e-42|43.0|221/235 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->192|PF00849|3e-11|35.9|128/149|PseudoU_synth_2 121: . . + . . .: 180 :VLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIR:Sequence :HHHcGGGcccEEEEEEEcccccHHHHHHHHTccccccccccccEEEEcEEEEEEcccEEE:Sec Str :============================================================:RP:SCP|61->235|1kskA4|1e-39|41.1|168/172|d.265.1.3 :============================================================:BL:SWS|1->232|RSUA_YERPE|6e-42|43.0|221/235 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|64->192|PF00849|3e-11|35.9|128/149|PseudoU_synth_2 181: . * . . . .: 240 :VTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERGEWRRLTKEELEILRANII:Sequence :EEEccccTTHHHHHHHHTTccEEEEEEEEETTEEcTTTccTTcEEEccHHHHHHHHHGcc:Sec Str :======================================================= :RP:SCP|61->235|1kskA4|1e-39|41.1|168/172|d.265.1.3 :==================================================== :BL:SWS|1->232|RSUA_YERPE|6e-42|43.0|221/235 :$$$$$$$$$$$$ :RP:PFM|64->192|PF00849|3e-11|35.9|128/149|PseudoU_synth_2