[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56413.1 spne4 ACF56413.1 "ribosomal small subunit pseudouridine synthase A"
MRLDKFLVACAVGSRTEVKNLLKAGRVTVNGKKEKSAKLQIDEKIDEIRFDGQVLEYEEF
VYYMMNKPKGVISATEDPKHRTVLDLLDDLARSKEVFPVGRLDIDTHGLLLLTNNGQLAH
VLLSPKRHVDKTYQAQVKGIMTQEDVETFIKGIPLKDFTCQPARLEILSTDAEKNQSQIR
VTIAEGKFHQIKRMVGYCGKEVVDLQRLTMGTLVLDENLERGEWRRLTKEELEILRANII
//