[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56432.1"

            "oligopeptide ABC transporter, oligopeptide-binding protein"
ALIB_STRR6  "RecName: Full=Oligopeptide-binding protein aliB;Flags: Precursor;"

OrgPattern 11-----------------1---1--------------------------111--------------- --1-----------------------------------11---3-1-----------1--1--------1--111211----1-1-11------------------1--111111113333333----------1-12211--1331-1-11-11-----------31131------------31---22-222CDEDFCEEAEEFCCD5-2222FEF2124154433335H211111112111111111111D796575--2-77--66222143343333233241134444444444-1111111111115--762---21215222222222232-2232223-1111-1--11-----1--2251-15-1----------21118------1-22232232227-1121121254--74462124433421-12-134134-----------------62----------------------------------------311313-111111321111-22162111-------------111-------31--------------------------------11----------------------1-----1-1-------44---2----------1---------------1-1--------45544544444443434-4443444343444444443454756643323333333333334622433334-544444444444---------------412444122-33324-23--------14-13333212312122-4321-11-11---11122222233211-----------------G------555252123--------------------------------2221124- -------------1------------------------------------------------------------------------------------------------------------------------------------------------1----1---------------------1------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKKSKSKYLTLAGLVLGTGVLLSACGNSSTASKTYNYVYSSDPSSLNYLAENRAATSDIV:Sequence : ccTTcccccccEEEEEcccccccccTTccccHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|9->22|ltlaglvlgtgvll : ============================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 61: . . . * . .: 120 :ANLVDGLLENDQYGNIIPSLAEDWTVSQDGLTYTYKLRKDAKWFTSEGEEYAPVTAQDFV:Sequence :HHHccccEEEcTTccEEEccEEEEEEEETTTEEEEEEcTTcccTTccccccccccHHHHH:Sec Str : ####################### :PROS|81->103|PS01040|SBP_BACTERIAL_5|PDOC00799| :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 121: . . + . . .: 180 :TGLQYAADKKSEALYLVQDSVAGLDDYITGKTSDFSTVGVKALDDQTVQYTLVKPELYWN:Sequence :HHHHHHHcGGGcTTHHHHTTcTTHHHHHTTccHcGGGccEEEEETTEEEEEcccccTTGG:Sec Str :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 181: . * . . . .: 240 :SKTLATILFPVNADFLKSKGDDFGKADPSSILYNGPFLMKALVSKSAIEYKKNPNYWDAK:Sequence :GGGGcGGGccccHHHHHHHGGGGcTGcTTTccccccEEEEEEETTTEEEEEEcTTcTTGG:Sec Str :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 241: + . . . . *: 300 :NVFVDDVKLTYYDGSDQESLERNFTAGAYTTARLFPNSSSYEGIKEKYKNNIIYSMQNST:Sequence :GccccEcEEEEEccccHHHHHHHHHTTccccccccccTTTHHHHHHHcGGGEEEEEEEEE:Sec Str :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 301: . . . . + .: 360 :SYFFNFNLDRKSYNYTSKTSDIEKKSTQEAVLNKNFRQAINFAFDRTSYGAQSEGKEGAT:Sequence :EEEEEEcTTcTTTTTTETTTTEEEcccccGGGcHHHHHHHHHHccHHHHHHTTTTHHHHH:Sec Str :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 361: . . . * . .: 420 :KILRNLVVPPNFVSIKGKDFGEVVASKMVNYGKEWQGINFADGQDPYYNPEKAKAKFAEA:Sequence :TTTccccEEccccccTTcTTccccHHHcTTccccccHcccHHHccHHHHHHHHHHHHHHT:Sec Str : XXXXXXXXXX:SEG|411->427|ekakakfaeakkeleak :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 421: . . + . . .: 480 :KKELEAKGVQFPIHLDKTVEVTDKVGIQGVSSIKQSIESVLGSDNVVIDIQQLTSDEFDS:Sequence :HHHHHHTTcTcccccccEEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEEEcHHHHHc:Sec Str :XXXXXXX :SEG|411->427|ekakakfaeakkeleak :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 481: . * . . . .: 540 :SGYFAQTAAQKDYDLYHGGWGPDYQDPSTYLDIFNTNSGGVLXNLGLEPGEXNDKAKAVG:Sequence :HHHHHHHHHHTcccEEEEEEEcccccTHHHHGGGcTTcTTcccccccHHccccHHHTcTT:Sec Str :============================================================:RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|75->520|PF00496|2e-26|32.0|359/366|SBP_bac_5 541: + . . . . *: 600 :LDVYTQMLEEANKEQDPAKRYEKYADIQAWLIDSSLVLPSVSRGGTPSLRRTVPFAAAYG:Sequence :HHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEEETTE :Sec Str :======================================= :RP:SCP|33->579|1dpeA|7e-51|20.0|469/507|c.94.1.1 :============================================================:BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652 601: . . . . + .: 660 :LTGTKGVESYKYLKVQDKIVTTDEYAKAREKWLKEKEESNKKAQEELAKHVK :Sequence : :Sec Str :==================================================== :BL:SWS|1->652|ALIB_STRR6|0.0|99.5|652/652