[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56466.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------111--------------------------------------------------------------1----------------------------------------11111-222111111111111111222222111212121122222211-22222222222222212121112222112111112212112111122222221111111111111122222222222221112221112213222222222121-1221222221112222-22---2211-2222--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTVKIXTKDGQXELTDEVIATVVGGAATEIFGVVGMASKNALKDNFQALLGKENYSKGVV:Sequence :============================================================:BL:SWS|1->121|Y1614_STRP6|8e-49|79.2|120/121 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|10->113|PF03780|7e-16|47.5|101/107|DUF322 61: . . . * . .: 120 :VKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGITAQTVNVYIQNIKVVG:Sequence :============================================================:BL:SWS|1->121|Y1614_STRP6|8e-49|79.2|120/121 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|10->113|PF03780|7e-16|47.5|101/107|DUF322 121: . . + . . .: 180 :E :Sequence := :BL:SWS|1->121|Y1614_STRP6|8e-49|79.2|120/121