[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56466.1 spne4 ACF56466.1 "conserved hypothetical protein"
MTVKIXTKDGQXELTDEVIATVVGGAATEIFGVVGMASKNALKDNFQALLGKENYSKGVV
VKAAEDGSIAVDVYTVLSYGTKISEVSKNIQERVAFSLENQLGITAQTVNVYIQNIKVVG
E
//