[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56471.1"

            "hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11114--34444444444-1111111111115--442-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MVLSTLAILVACGKTDKEADAPTTFSYVYAVDPASLGYSIATRTSTTDVIGNVIDGLMEN:Sequence : ccccTTcccccccEEEEEcccccccccTTccccHHHHHHHHHHccccEEc:Sec Str : ==================================================:RP:SCP|11->68|1b05A|8e-05|17.2|58/517|c.94.1.1 : =:RP:SCP|60->160|1uqwA|3e-06|16.5|91/487|c.94.1.1 : ==========================:BL:SWS|35->234|SARA_STRGC|8e-37|39.9|198/663 61: . . . * . .: 120 :DKYGNVAPSQKDYDLNSTGWAPSYQDPASYLNIMDPKSGSAMKHLGITKGKDKDVVAKPG:Sequence :HHHHTcGGGTccccEEEEEEEcccccccGGGccccTTTccccccccGGGTTccccTTccc:Sec Str :======== :RP:SCP|11->68|1b05A|8e-05|17.2|58/517|c.94.1.1 :============================================================:RP:SCP|60->160|1uqwA|3e-06|16.5|91/487|c.94.1.1 :============================================================:BL:SWS|35->234|SARA_STRGC|8e-37|39.9|198/663 121: . . + . . .: 180 :LDKYKKLLEDAVSETTDLEKRYEKYAKAQAWSTDSSLLMPTASSGGSPVVSNVVPFSKPY:Sequence :cHHHHHHHHHHTTcGccHHHHHHHHHHHHHHHHHHccEEE :Sec Str : XXXXXXXXXXXXX :SEG|163->175|ssggspvvsnvvp :======================================== :RP:SCP|60->160|1uqwA|3e-06|16.5|91/487|c.94.1.1 :============================================================:BL:SWS|35->234|SARA_STRGC|8e-37|39.9|198/663 181: . * . . . .: 240 :SQVGIKGEPYIFKGMKLQKDIVTTKEYNEVFKKWQKEKLESNSKYQKELEKYIK :Sequence : :Sec Str :====================================================== :BL:SWS|35->234|SARA_STRGC|8e-37|39.9|198/663