[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56555.1"

            "conserved hypothetical protein"
            ""

OrgPattern -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------1--111-1--11------------221111132263333333-------------222221222----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAILLITISETLPQVLQI:Sequence : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|3->74|PF05977|4e-05|43.1|72/402|DUF894 61: . . . * . .: 120 :FLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLVAFICLINLLSDTLSYF:Sequence : XXXXXXXXXXXXX :SEG|91->103|slslsgqsfslll :$$$$$$$$$$$$$$ :RP:PFM|3->74|PF05977|4e-05|43.1|72/402|DUF894 121: . . + . . .: 180 :SGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVLLGILSIQFISLLNALTF:Sequence : XXXXXXXXXXXXXXX :SEG|155->169|isnilggvllgilsi 181: . * . . . .: 240 :LIAFLGILFIKTDLLKVEKTINYQEGLSVKSFCQHLLQSSKLIWNMNKVLLVLFIISTSQ:Sequence : ===================:BL:SWS|222->316|CCSA_MICAN|5e-04|30.2|86/100 241: + . . . . *: 300 :AVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALIVGSLVSGYLQHTISIKTALY:Sequence :============================================================:BL:SWS|222->316|CCSA_MICAN|5e-04|30.2|86/100 301: . . . . + .: 360 :ASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQELVFKQIPXESMGAVQSSIS:Sequence :================ :BL:SWS|222->316|CCSA_MICAN|5e-04|30.2|86/100 361: . . . * . .: 420 :AXTVVLPSLFTISLVTIATSFGTLAVSFVLLLFXLVAFVMLLNIRESI :Sequence : XXXXXXXXXXXXXXXXXXX :SEG|384->402|lavsfvlllfxlvafvmll