[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56555.1 spne4 ACF56555.1 "conserved hypothetical protein"
MKVFLQNRDFRQLTINQWISTLGDTIFYLAFLNYVADASFAPLAILLITISETLPQVLQI
FLGVLADFQHHRVLKYTVISFAKFLLYSIVSLSLSGQSFSLLLVAFICLINLLSDTLSYF
SGAMLTPIFIRIIGQDHLAEAIGFKQSTVSLVKTISNILGGVLLGILSIQFISLLNALTF
LIAFLGILFIKTDLLKVEKTINYQEGLSVKSFCQHLLQSSKLIWNMNKVLLVLFIISTSQ
AVINVTVPVSTLFLRNQPFLNLQTGQSLALLSTFELSALIVGSLVSGYLQHTISIKTALY
ASLVIQLLLLVGFATVRFDWILIFSTLDAFFAGVLSPRLQELVFKQIPXESMGAVQSSIS
AXTVVLPSLFTISLVTIATSFGTLAVSFVLLLFXLVAFVMLLNIRESI
//