[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56614.1"

            "LysM domain protein"
            ""

OrgPattern -------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1242--222324433--231--1---111----11111111111111--------------11111111---------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAEN:Sequence : ccccccEEEEEEcccTTccHHHHHHHHTccHHHHHHH:Sec Str : XXXXXXXXXXXXXX :SEG|10->23|atlagvaalfavfa : ==============================:RP:SCP|31->77|1e0gA|8e-10|28.9|45/48|d.7.1.1 : =============================:BL:SWS|32->77|XLYA_BACSU|9e-07|47.8|46/297 61: . . . * . .: 120 :NHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTV:Sequence :HTccccccGGGcccEEE :Sec Str : XXXXXXXXXXXXXXXXXX :SEG|80->97|pvapvatpapatyaapaa : XXXXXXXXXXXXXXX:SEG|106->127|vaetpvvsetvvstvsgseaea :================= :RP:SCP|31->77|1e0gA|8e-10|28.9|45/48|d.7.1.1 :================= :BL:SWS|32->77|XLYA_BACSU|9e-07|47.8|46/297 121: . . + . . .: 180 :SGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYG:Sequence : :Sec Str :XXXXXXX :SEG|106->127|vaetpvvsetvvstvsgseaea 181: . * . . . .: 240 :SWTAAKNFWLNNGWY :Sequence : :Sec Str