[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56614.1 spne4 ACF56614.1 "LysM domain protein"
MKSITKKIKATLAGVAALFAVFAPSFVSAQESSTYTVKEGDTLSEIAETHNTTVEKLAEN
NHIDNIHLIYVDQELVIDGPVAPVATPAPATYAAPAAQDETVSAPVAETPVVSETVVSTV
SGSEAEAKEWIAQKESGGSYTATNGRYIGRYQLTDSYLNGDYSAENQERVADAYVAGRYG
SWTAAKNFWLNNGWY
//