[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]

Summary of "spne4:ACF56680.1"

            "cytoplasmic membrane protein"
            ""

OrgPattern ------------------------1-------21--1------11-11--1-1--------------- 111--------1--1------1---1------1111---------1-1-111------11--1--------111111111111-----2241-111---11421112111--------------111111111--1-----222--1--111-----------------1--1-----1---------112------------------1-------------11111111--1--------------1----11111111111111111111111---1111222111111111111111111111111111111111111111--11111111-1---11-----1-21-----22---1--1-22121112--111211111112222121222311111111111-1111111111--111-1111111111111-----------------------2--------------------------------21211111111------1111---11111111211211--2211113113211-22112211--------2111211-11--11-2-----21221112-2222-11-121-1-----------------1-1--111-11-1---1-111--211111122111--211-1---------------11-111---1---1-11--111-----1-1--12-2---------------------------11111111111---11111111111211-1111111-------12222211121112212-3111----2---111111111-----------1-111111111111----11--11--11--------111-------1-111-1111-1--111112-1111111-3- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------

Master   AminoSeq   


1: . . . . + .: 60 :MTWIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAK:Sequence : HHHHHHHHHHHHHHHHHHHHHHHHHHH HHcT:Sec Str : ======================================:RP:SCP|23->168|2etdA1|1e-43|41.9|136/139|a.29.9.1 : ===================================:BL:SWS|26->181|Y1576_METJA|1e-28|39.1|156/189 : $$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->178|PF04011|3e-49|50.9|175/184|LemA 61: . . . * . .: 120 :YEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQE:Sequence :Tc HHHHHHHHHHHHHHc cHHHHHHHHHHHHHHHHHHHHHHTTcHHH HcHHHHHH H:Sec Str :============================================================:RP:SCP|23->168|2etdA1|1e-43|41.9|136/139|a.29.9.1 :============================================================:BL:SWS|26->181|Y1576_METJA|1e-28|39.1|156/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$:RP:PFM|4->178|PF04011|3e-49|50.9|175/184|LemA 121: . . + . . .: 180 :ELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVD:Sequence :HHHHHHHHHHHHHHHHHHHHHHHHHccc :Sec Str :================================================ :RP:SCP|23->168|2etdA1|1e-43|41.9|136/139|a.29.9.1 :============================================================:BL:SWS|26->181|Y1576_METJA|1e-28|39.1|156/189 :$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$ :RP:PFM|4->178|PF04011|3e-49|50.9|175/184|LemA 181: . * . . . .: 240 :FSGLGD :Sequence : :Sec Str := :BL:SWS|26->181|Y1576_METJA|1e-28|39.1|156/189