[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
>ACF56680.1 spne4 ACF56680.1 "cytoplasmic membrane protein"
MTWIILGVLALVVIFVIVSYNGLVKNRMQTKEAWSQIDVQLKRRNDLLPNLIETVKGYAK
YEGSTLEKVAELRNQVAAATSPAEAMKASDALTRQVSGIFAVAESYPDLKASANFVKLQE
ELTNTENKISYSRQLYNSVVSNYNVKLETFPSNIIAGMFGFKAADFLQTPEEEKSVPKVD
FSGLGD
//